SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000059887 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000059887
Domain Number 1 Region: 2-271
Classification Level Classification E-value
Superfamily Sema domain 3.92e-38
Family Sema domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000059887   Gene: ENSXETG00000030557   Transcript: ENSXETT00000062201
Sequence length 276
Comment pep:known_by_projection scaffold:JGI_4.2:GL172931.1:75547:83439:-1 gene:ENSXETG00000030557 transcript:ENSXETT00000062201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKLYVGGTNILYLLDFTTKEINKVQGPVYLCFYLCMHTGACLDCTDCMIYVTLAGQLNRS
LIICGTSGTRTACWKLVENNNLVLIIGEHYILVQILSLVTALPSIRTLSFILENEVYSTN
NGRRDKYIFKKIYGQQPFLYTGDGFMRKPHYIKALVVDSKEKYQDKILLFFREDNENVRS
TEKRISMVARMCKEDSGPTKLSSYYMFSTALKSRLICGYPKKGQYFPHLQDVFLLKGKEE
NLIYGLFTNAWNHSAVCSYNLLDIEKTFSSSSLWNA
Download sequence
Identical sequences F7ENV8
ENSXETP00000059887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]