SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000059989 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000059989
Domain Number 1 Region: 27-499
Classification Level Classification E-value
Superfamily Sema domain 2.49e-172
Family Sema domain 0.00000000000157
Further Details:      
 
Domain Number 2 Region: 501-549
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000051
Family Plexin repeat 0.00062
Further Details:      
 
Domain Number 3 Region: 609-681
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000736
Family I set domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000059989   Gene: ENSXETG00000010843   Transcript: ENSXETT00000064925
Sequence length 729
Comment pep:known scaffold:JGI_4.2:GL172892.1:375473:417716:-1 gene:ENSXETG00000010843 transcript:ENSXETT00000064925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFNVAFNALYLVLCTAFGAAEFGPAPRITWHLKETNLMHFHVSGISNYSTLLLSEEKDV
LYVGAREAIFAVSSLNVAEKLHEAYWKVSDEKNNECAWKGKSKQTECLNYIRVIQPLNDK
TLYVCGTNAFQPTCDYLNLTDFRLLGRNEDGKGRCPFDPAQSYISVMVDGELYSGTSFNF
LGSEPIIFRHSSQSQLRTEYAVPWLNEPSFVYADVIRAPANNPEGDDDKVYFFFTEVSVE
YEFFSKLLIPRVARVCKGDQGGLRTLQKKWTSFLKAKLICHSSENNLIFNVVSDVFILKH
SDSSEPKIYGVFTSHLNNVGLSAVCAYNVSTVEEVFAKGKYMHSATVEQSNTKWVRYNGE
VPKPRPGACINNEARAMNYTSSLNLPDMTLQFVKDHPLMDDSVSPVGNKPKLVLRDVIYT
QIVVDRVKALDGNSYDIMFLSTDKGILHKAVSQDAEMRIIEEIVLFPHLQPVQTLLLSNK
EGKRFIYAGSNTGVVQSPLAFCEKFTSCKDCILTRDPYCAWHPVKRSCVNILQDSTADGS
LIQKLNGDASQCPASAPIPFPPSATSSLSSVRPDFHPSLPSMQPEVLSSAESDVVRLLPP
SLRDQGHIVSAQGTFHLFCHALGPEDAHFTWEKDGVIMEGCWKEEQHGLADGTVHILSWV
KDIATHDAEYFCTVKSKRGFKVSKGFIKVAGGSGQRWTPELAKWKAAVSEHSSIMEGWKK
TWESCNKKS
Download sequence
Identical sequences B3DLC3
ENSXETP00000059989 NP_001161470.1.99540 XP_012814329.1.99540 gi|189442633|gb|AAI67391| gi|269784798|ref|NP_001161470|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]