SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000060046 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000060046
Domain Number 1 Region: 9-100
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-27
Family PDZ domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000060046   Gene: ENSXETG00000033493   Transcript: ENSXETT00000063155
Sequence length 145
Comment pep:known scaffold:JGI_4.2:GL172882.1:887686:900594:1 gene:ENSXETG00000033493 transcript:ENSXETT00000063155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGALAAVEEIALTRGPSGLGFNIIGGTDQDYIAHDSGIYVSSIKEKGSAAADGRLQEG
DQILEVNGVKLEDLLHSAAVDLFRNAGEHVVLKVRHKVQNQQNGPLSTRSERDSEDSSLA
MLAIPVLLSVAAFAIFAIVKYRQRM
Download sequence
Identical sequences A9JTW3
ENSXETP00000060046 gi|160773650|gb|AAI55514| gi|163915055|ref|NP_001106384| NP_001106384.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]