SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000060226 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000060226
Domain Number 1 Region: 109-218
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-16
Family Scavenger receptor cysteine-rich (SRCR) domain 0.013
Further Details:      
 
Domain Number 2 Region: 330-379
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.3e-16
Family Eukaryotic proteases 0.019
Further Details:      
 
Domain Number 3 Region: 217-255
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000772
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 4 Region: 261-291
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000668
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000060226   Gene: ENSXETG00000024110   Transcript: ENSXETT00000063871
Sequence length 379
Comment pep:known scaffold:JGI_4.2:GL172725.1:754794:769837:1 gene:ENSXETG00000024110 transcript:ENSXETT00000063871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVICKTHLLLFCNSLLQSSFSGAEDVRPNKCEFTSLSCHKVFCAPWQRCVAGVCRCKLPY
QCPRNATTEVCTEGKRKLQTYCQQKSVECSNPSNVKYRFSSEAPCTEGDTFSVRLTGSKE
TSKGIIKVKLPTLEKELFICAKQWSLREANVVCKQLGFPRGADAPASNKDLPLVTKESPE
EHCLQATCRGLENSLAECALRKLPVEKQVAEVKCYTENRDCGSGEFKCSNGKCIPSELAC
DSENDCGDLSDELCCKDCSAGFHCKSDTCIPERYKCNGELDCISEEDESNCEETGNIVNY
DMDADKERRLVMKSLPELSCGVPPPAAPTKITRKKRVIGGTNAVKNQFPWQVAIKDGTSV
NCGGIYIGGCWVLTAAHCV
Download sequence
Identical sequences F7C8F4
ENSXETP00000060226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]