SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000060263 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000060263
Domain Number 1 Region: 10-162
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.25e-27
Family Calponin-homology domain, CH-domain 0.0058
Further Details:      
 
Domain Number 2 Region: 189-265
Classification Level Classification E-value
Superfamily GAS2 domain-like 2.62e-26
Family GAS2 domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000060263   Gene: ENSXETG00000013478   Transcript: ENSXETT00000063857
Sequence length 775
Comment pep:known scaffold:JGI_4.2:GL172708.1:893116:918692:1 gene:ENSXETG00000013478 transcript:ENSXETT00000063857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGSVRSIRPFKSSEEYLYAMKEDLAEWLKDMYNLEVFVDNFIEILGNGSVLCQHANNVTE
VAREFAVQYPHLAEKLQLPKSGVKLNMMAQPGTFLARDNVSNFIQWCRKEMDIKDVLMFE
TEDLVLRKNEKNFVLCLLELARRASRFGMSAPMLIQMEEQIEEEIREEMDLPPQEIPVPK
PQRKLCDFKNLDQMVQHLVSRCTCPVQFSMIKVSEGKYKVGESSTLIFVRILRNHVMVRV
GGGWDTLEHYLDKHDPCRCTSLSHKPAIKLGSLQKQLSAVHEVKTRLTPRLDNPSKLETT
LIVSRSQSPLPPVEWRTYSSGRSRTLSSIKPRSDKGSKWGARRVLALFLSIKAVSLVNDW
VQGTCIDNAVKPRSDKGYRAHERSATPSRKLFTEDNREPQQLATPRSGHYRHHHSTSSLA
SQLTGSEEENSCISEVFSESQSGKQMGKSTFTSLKEPSVKDASYRKVMSATEPSNTQQGS
RNVHQSINSQDSRPKTPSRFIRPPSPSKINKAKDWNRTPRPRLLVTQDLLLHKNGIMQSE
HKVSNLPLRMQRKPEAIETSQSIERDCMYTPLPIDPEQEKQIYRSLEDEILTNIKVLEGE
SEKPMGQEGVPRSGVYINTTWQSGASYDDVITELTKGHVKLNRVDVENWISKIPSKGIVK
EADTSQRNKKTLSTEMKGSKPKQLPSQRARQLALENKKKMVENVSENQASTVSGNSEDAV
EEKIKLPQGLKPKRSLKKPERVPSIYKLKLRPKIRPRRDNRPEKKASRIPTPVSY
Download sequence
Identical sequences F7BNV6
ENSXETP00000060263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]