SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000060310 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000060310
Domain Number 1 Region: 6-74
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000969
Family Calponin-homology domain, CH-domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000060310   Gene: ENSXETG00000032089   Transcript: ENSXETT00000064562
Sequence length 239
Comment pep:known_by_projection scaffold:JGI_4.2:GL172834.1:294755:303814:1 gene:ENSXETG00000032089 transcript:ENSXETT00000064562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVEFDEETLQELYSWVDRIPLSRPKRNIARDFSDGVLTAELVKFYFPKIVEMHNYVPAN
STTQKFSNWNILNRKVLSKLSFSVPDDVIRKIVQCSPGVVELVLNTLRQKIEEKQRVNQI
SAEFSQEQAPQNTTNIHSDKATAQNSAQDQVPRPIQQDKCNTGHNTTPGIKTHQGYAQAA
NADTALRFQLAEKEQALILSQETIQQILQAKLRRMEQLLQLKNVRIDDLTRRLQELEKK
Download sequence
Identical sequences F6XNR0
ENSXETP00000060310 ENSXETP00000060310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]