SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000060328 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000060328
Domain Number 1 Region: 21-244
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.24e-68
Family Eukaryotic proteases 0.00000954
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000060328   Gene: ENSXETG00000021647   Transcript: ENSXETT00000065338
Sequence length 265
Comment pep:known scaffold:JGI_4.2:GL172925.1:1219044:1223964:-1 gene:ENSXETG00000021647 transcript:ENSXETT00000065338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHHLLVTLSILWASQVNGGSMHTQIVGGREATPNSHPYIASLQLRGRHFCGGSLIAPQF
LMTAAHCMENTASNLVTVVLGAHSLRANEATKQRFRVNQVFENGFNPLTLQNDIVILKLD
RPVSLNGKVQVVSLPSANEDVPAGTQCVTAGWGRLSTEGQIPDRLQELNVTVTRQNLCRP
NNICTGVFMQQAGICFGDSGGPLVCNGVIQGITSFIIRSCGNGVTPDFFSRVSLFRRFID
DAINRYFKLQYPVFRKPFPASTVLF
Download sequence
Identical sequences F6WWJ8
ENSXETP00000060328 ENSXETP00000060328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]