SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000060358 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000060358
Domain Number 1 Region: 59-285
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.26e-54
Family Ecto-ART 0.0000255
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000060358   Gene: ENSXETG00000031855   Transcript: ENSXETT00000064932
Sequence length 300
Comment pep:known scaffold:JGI_4.2:GL173612.1:230007:233486:-1 gene:ENSXETG00000031855 transcript:ENSXETT00000064932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YIRILLICLKISKDDTFYSISDYYEVIGAERISNGSCPGQDPVRSYNPVPERKCNLLNLD
LMPNAFDDEYEGCAEELERDSMPKVLKMETYQNPVFGLAWKRAEKDWDKVKSTLRLPLGF
ADTFGTAIRVYTTDWPEGNPLYKAFNGNVSSAGRSREHYMEHFHFKALHFYLTRAMQVLR
RNSRRRYRTYRGTDGSYEVSEELLRFGRFTSSSLNVEVAKGYNAGLLFEITTCFGVDIHR
VSFFPKEREVLIPVAEKFHYVGKRDNIYVMNSTCQLCTYFNCAYLGGEKREVPVCSSGRF
Download sequence
Identical sequences F6W5E3
ENSXETP00000056781 ENSXETP00000060358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]