SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000060752 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000060752
Domain Number 1 Region: 39-515
Classification Level Classification E-value
Superfamily Sema domain 9.16e-168
Family Sema domain 0.00000000014
Further Details:      
 
Domain Number 2 Region: 511-565
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000209
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 3 Region: 584-665
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000527
Family I set domains 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000060752   Gene: ENSXETG00000031133   Transcript: ENSXETT00000061219
Sequence length 768
Comment pep:known_by_projection scaffold:JGI_4.2:GL172774.1:2125679:2164186:1 gene:ENSXETG00000031133 transcript:ENSXETT00000061219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWFSKCFSGNLLSECKIMNPTPKYNVPRVRVELRDLNRTSVFHSPFLDLNIMYLDEYQER
LFVGGRNLLYSLSLEQVSENYKEIHWPSTDQQVEDCSRKGRDKSECANFIRVLHHYNRTH
LLACGTGAFDPVCAFIRAGLRSQEHLFQLEPQKFERGRGRCPFDPNSSVISTLTDQGGEL
FVGLYNDFWGRDATIFRTTGHLPPIRTEHDDDRILTEPKFVGSYMIPDNEDKDDNKMYFF
YTEKAIEGDKGVQAIYSRVGRVCANDIGGQRMMVNKWTTFLKTRLICSVPGPNGIDTFFD
ELEDVFLLHTRDNKNPEIFALFSTTSNIFKGYAICVYHMASIREAFNGPFAHKEGPEYHW
SIYEGKIPYPRPGLCASKVNGGHYGTTKDYPDEALRFARSHPLMYESVKPTHKKPILIKA
DGKYNLKQIAVDRVEAEDGQYHVVFIGTDNGIVLKVITIYNQETETMEEVILEELQVFKV
PDPIISMEISAKRQQLYIGSASSIVQIKTHQCEMYGTACADCCLARDPYCAWDGISCSRY
YPLGSHSKRRFRRQDVRHGNAVQQCFGQQFHGETLEKTEEHLAYGIENNSTLLECMPRSL
QSKVVWFVQRGHDTRKEEVKTDERVVKTDFGLLFFKLHKMDAGIYFCQTVEHMFVHIIRK
ITLEIVDEERVDDMFHKEEEEEPVAKMPCPVQAHVPQATRPWYKEFLQLIGYSNFHKVEE
YCEKVWCTDRRRKKLKAPQNKWKYGNPQERKPKVKSEHYRIPRHLTGL
Download sequence
Identical sequences F6YD58
ENSXETP00000060752 ENSXETP00000060752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]