SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000060771 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000060771
Domain Number 1 Region: 13-133
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-20
Family V set domains (antibody variable domain-like) 0.0053
Further Details:      
 
Domain Number 2 Region: 138-228
Classification Level Classification E-value
Superfamily Immunoglobulin 9.5e-19
Family C1 set domains (antibody constant domain-like) 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000060771   Gene: ENSXETG00000031737   Transcript: ENSXETT00000065625
Sequence length 308
Comment pep:novel scaffold:JGI_4.2:GL173120.1:715850:776276:-1 gene:ENSXETG00000031737 transcript:ENSXETT00000065625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDLVSCQELKIYQSPTSIIKAKGKTAKFVCNVEGLSVIKNGLHLYHQDRNNSVEWLLF
YRPSQQEISDKYKNRVSLDTQGDKACTLSITSINPDDAGIYFCAAWYIKPPLCKDANLKI
FGTGTRLFVTSNARSAEQPKSTILSPSLKEMERTGQGIYLCLLENFFPDVIQVVWKSGDQ
DIPSEQQEIKGVPDKDGNTLYSVTSWITVSKNDIGKRFTCRYKHEGISKLENWDEISVAE
SKPPKVVPGSEKKEETCPAGDTGDTMNYPNPSSQRAAYLTYLLLITKSALYGPIMFFIIY
RTKILFCF
Download sequence
Identical sequences F6XKK5
ENSXETP00000060771 ENSXETP00000060771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]