SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Xenopus tropicalis 76_4.2 > ENSXETP00000061042

Domain assignment for ENSXETP00000061042 from Xenopus tropicalis 76_4.2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSXETP00000061042
Domain Number 1	Region: 6-157
Classification Level	Classification	E-value
Superfamily	TRADD, N-terminal domain	2.09e-53
Family	TRADD, N-terminal domain	0.0000291
Further Details:

Domain Number 2	Region: 204-299
Classification Level	Classification	E-value
Superfamily	DEATH domain	1.74e-17
Family	DEATH domain, DD	0.0094
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSXETP00000061042 Gene: ENSXETG00000031794 Transcript: ENSXETT00000062823
Sequence length	303
Comment	pep:known_by_projection scaffold:JGI_4.2:GL172906.1:585179:589073:-1 gene:ENSXETG00000031794 transcript:ENSXETT00000062823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MAAGSSMWVGSVYLYIKSDEVSLPRKYTDQKALIYEALRSAISESTGGCRDSIEILKIHS SDQQLILYLKFCGLEPCQIFLKDYKERKLQMQIQNKLENCFSVAQLPIFTELKIDTGEMD SLLEKEEQCLKYISQMKPTIQKDDEFAEIDERLKSLKLVPPSALDSDLSSQNSSQCSLPL SLHSNRNSHIEGSTFYFQGEEFVDRPLTSTHIQHFAKSVGRNWKLVGRSLGKTCRALNDT AIENLAYEFDREGRYEQAYQLLRLFKDSEGKKATVQRLVQALEENGLNSIAFDLLSLNEN GLE
Download sequence
Identical sequences	F6YLU1 ENSXETP00000061042 gi\|301615521\|gb\|XP_002937214\| XP_002937214.1.99540 XP_004913591.1.99540 XP_012817698.1.99540 XP_012817699.1.99540 ENSXETP00000061042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]