SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000061162 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000061162
Domain Number 1 Region: 156-296
Classification Level Classification E-value
Superfamily TPR-like 3.25e-20
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000061162
Domain Number - Region: 111-160
Classification Level Classification E-value
Superfamily TPR-like 0.00022
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000061162   Gene: ENSXETG00000021053   Transcript: ENSXETT00000064488
Sequence length 313
Comment pep:novel scaffold:JGI_4.2:GL173293.1:292536:297837:1 gene:ENSXETG00000021053 transcript:ENSXETT00000064488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDREKRRLSGVLSSLSLFCVILDLQLDGLLAANHAEIEGHLEMGRKLLERRILEALSHYH
AAVVGQRLYIHNFHPIGRLEIVGGFMQVLGCPVAKARGRRGTEIGQVWVVNILLKQGDVQ
EAREDFLSVLQSSPTNEEAQNQLERVKEVESSMGGASEAYERRDYYGAIALLEKVIEFSP
WDPSARELRAECYLLVGELSNAVQDLKPTTKLRNDNRAAFLKLSKLYYSMGEHGESLSHV
RECLKLDQDDKDCFSHYKQVKKLSRQLDMAEEFIQEQRYEDAIEKYEASIKTEPRVEEYS
RRAKERICHCLSK
Download sequence
Identical sequences F6T7C5
ENSXETP00000061162 ENSXETP00000061162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]