SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000061192 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000061192
Domain Number 1 Region: 109-218
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-16
Family Scavenger receptor cysteine-rich (SRCR) domain 0.013
Further Details:      
 
Domain Number 2 Region: 217-255
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000615
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 3 Region: 261-293
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000061192   Gene: ENSXETG00000024110   Transcript: ENSXETT00000066121
Sequence length 355
Comment pep:known scaffold:JGI_4.2:GL172725.1:754794:769148:1 gene:ENSXETG00000024110 transcript:ENSXETT00000066121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVICKTHLLLFCNSLLQSSFSGAEDVRPNKCEFTSLSCHKVFCAPWQRCVAGVCRCKLPY
QCPRNATTEVCTEGKRKLQTYCQQKSVECSNPSNVKYRFSSEAPCTDENTFSVRLTGSKE
TSKGIIKVKLPTLEKELFICAKQWSLREANVVCKQLGFPRGADAPASNKDLPLVTKESPE
EHCLQATCRGLENSLAECALRKLPVEKQVAEVKCYTENRDCGSGEFKCSNGKCIPSELAC
DSENDCGDLSDELCCKDCSAGFHCKSDTCIPERYKCNGELDCISEEDESNCEVVAHLVSL
FASTETGNIVNYDMDADKERRLVMKSLPELSCGVPPPAAPTKITRKKRVIGGTNA
Download sequence
Identical sequences F6SFR7
ENSXETP00000061192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]