SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000061225 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000061225
Domain Number 1 Region: 19-110
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 3.79e-28
Family Cytochrome b5 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000061225
Domain Number - Region: 347-401
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0711
Family Calponin-homology domain, CH-domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000061225   Gene: ENSXETG00000009043   Transcript: ENSXETT00000065908
Sequence length 446
Comment pep:known scaffold:JGI_4.2:GL173805.1:43800:67975:-1 gene:ENSXETG00000009043 transcript:ENSXETT00000065908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGMGGQSGEGCSSGNCVKPEARYSWEEIQKHNLKTDKWLVIERKVYNITQWVKCHPGGMR
VIGHYAGEDATDAFHAFHPDKNFVRKFLKPLYVGELAENEPSQDRDKNAQQVEDFRALRK
TAEDMGLFKSNPAFFIVYLFHILLIEFLAWCTLHYFGTGWIPTILTVLLLTISQAQAGWL
QHDFGHLSVFKKSKWNHLIHKFIIGHLKGASANWWNHRHFQHHAKPNIFRKDPDVNMVNV
FVLGDTQPVEFGARNSLSLPGTSPPPYFLLVGPPLLIPIYFTIQIMKTMITRKDWVDLAW
SVSYYARFFITFVPFYGVLGSLALLNAVRFIESHWFVWVTQMNHLPMVIDHEKYKDWLET
QLAATCNIEPSFFNDWFSGHLNFQIEHHLFPTMPRHNYWKIAPLVRSLCSKYNVTYEEKC
LYHGFRDVFRSLKKSGQLWLDAYLHK
Download sequence
Identical sequences F7AIE0
ENSXETP00000061225 ENSXETP00000061225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]