SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000061604 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000061604
Domain Number 1 Region: 121-376
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.92e-81
Family Eukaryotic proteases 0.00033
Further Details:      
 
Domain Number 2 Region: 33-135
Classification Level Classification E-value
Superfamily SRCR-like 1.03e-16
Family Scavenger receptor cysteine-rich (SRCR) domain 0.071
Further Details:      
 
Domain Number 3 Region: 5-38
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000563
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000061604   Gene: ENSXETG00000031788   Transcript: ENSXETT00000061962
Sequence length 379
Comment pep:novel scaffold:JGI_4.2:GL173799.1:27847:37135:1 gene:ENSXETG00000031788 transcript:ENSXETT00000061962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDCEKECGTNGTCVLSAQWCDGVSDCPNGEDETSCVRLYGPNFQLQAYSPAKATWLPVCY
DEWSDNSGKIACQDIGYSMSSYYQSSQLLASSSNGYFVLQSSNVTGKMYTNLNYSATCAS
GNMVSLRCISCGLSTKVDSRIVGGTPASVGDWPWQVELLKLVGTSIYLCGGSIITPHWIV
TAAHCVYGSTSTPSAFKVFAGSLTIQSYYSAGYTVERALVHPSYSSYTQIYDVALLKLTA
ALVFTTNLRPVCLPNVGMPWAEGQPCWISGWGTTAEGGSISKNLMAASVPIISSTTCNQA
AVYGGAISSTMMCAGYLSGGTDTCQGDSGGPLVTKTNSLWWLVGDTSWGYGCARAYKPGV
YGNVTVFIEWIYSQMQVTH
Download sequence
Identical sequences F7AF05
ENSXETP00000061604 ENSXETP00000061604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]