SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000061677 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000061677
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-33
Family Calponin-homology domain, CH-domain 0.0000575
Further Details:      
 
Domain Number 2 Region: 155-184
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000613
Family LIM domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000061677
Domain Number - Region: 185-215
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0002
Family LIM domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000061677   Gene: ENSXETG00000006343   Transcript: ENSXETT00000060315
Sequence length 804
Comment pep:known scaffold:JGI_4.2:GL172724.1:463924:486495:1 gene:ENSXETG00000006343 transcript:ENSXETT00000060315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASRNLQQWCSRQCEGYPGILIYDLSSSFRDGLAFCALIHRHRPDLIDFDSLSKENVFE
NNRLAFEVAERELGIPALLDPEDMVSMKVPDRLSIMTYLSQYYNHFRNSSPGEHSARVGK
PQLKETSESPSKEPSGGSLPQGSPNAQTSLIRSSISSTCALCQQHVHLVQRYLVEGKLYH
RQCFRCKECSSTLVPGAYRPGTDAGTLVCTHHCHRPPTSSPESEEDGTKQKAVQTPPKPC
VPEKPASSNKPPTELHPDPFPNMRPVPAPRRTSDVAPQPLPRSRAAAESSPVRPTSLING
EQQSPAPPIPKPRSRQRSSEREDEEKQKKNPPWLSLVPATEPKRRAAPPPPPLAQKPELG
DEKSQKSLNDTEKQSLSSKPTAYNPFEDEDEEEEAETSSLKPGHPWYGITPTSSPKSRKR
LAPKAPNASPLAHHSNLVSRLSHSEPPSGSPSPALSTESLPTDASTKGQDPESVPKSSSE
PTIHSPNKPEPSDRDTTTYLSTGVPSTSTNTSLSSSSELANTSEAQVPTISIPSTVASDS
TPPEKKPLAKVSDRAGLPHMTLLRSALSFQQICKQNPFNRKSSPATSPINKRNQKGPKPS
RPPAPGHGFPLIKRKVQADDYIPEDEIQMEMETIELRLDELERRGVELEHRLRKLENESD
EDSLLVDWFKLIQEKHTLVRRESELVYTTKQQSLEQRQADVEYELRCLLNKPEKDWLEED
KEREQVLMQELVTLIEQRNAIVKCLDEDRQREKEEDKIIEAMILKKDFHTDPQKKKKGKF
KPIKVLKLLSPKQEPKVKSPKDKN
Download sequence
Identical sequences F6YHG8
ENSXETP00000061677 ENSXETP00000061677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]