SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000061727 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000061727
Domain Number 1 Region: 3-203
Classification Level Classification E-value
Superfamily Sema domain 2.22e-42
Family Sema domain 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000061727
Domain Number - Region: 200-220
Classification Level Classification E-value
Superfamily Plexin repeat 0.000138
Family Plexin repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000061727   Gene: ENSXETG00000030557   Transcript: ENSXETT00000066255
Sequence length 220
Comment pep:known_by_projection scaffold:JGI_4.2:GL172931.1:71435:78013:-1 gene:ENSXETG00000030557 transcript:ENSXETT00000066255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TALKSRLICGYPKKGQYFPHLQDVFLLKGKEENLIYGLFTNAWNHSAVCSYNLLDIEKTF
SSSSLWNAPASNLAIRPGTCILGDRTPEDTFNRASKYPELQDWIEPSGKEAVFQNLSHYR
KIVVDEVKALDGNSYRVILLAAAGGSVQKLVVMDNGDHSVHMINPFNETKEILSLILEPT
MHVLYVGTNTEVIRLPLDDCTAYNETCEACVSSRDPYCSW
Download sequence
Identical sequences F6PPR5
ENSXETP00000061727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]