SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000062218 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000062218
Domain Number 1 Region: 649-712
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000085
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 142-175
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 569-618
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000235
Family TSP-1 type 1 repeat 0.00063
Further Details:      
 
Domain Number 4 Region: 707-761
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000148
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 5 Region: 24-79
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 81-129
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000144
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000062218
Domain Number - Region: 523-564
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0259
Family Integrin beta EGF-like domains 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000062218   Gene: ENSXETG00000032196   Transcript: ENSXETT00000066037
Sequence length 940
Comment pep:novel scaffold:JGI_4.2:GL173201.1:593834:618929:-1 gene:ENSXETG00000032196 transcript:ENSXETT00000066037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSHLQIILLLTVLLAREALSCFCDHYPWTSWSSCSQTCAHGIQSRSRRTMSYDDYYWKN
NCSESCTTHETRSCNEQACPINCKLGDYGPWSVCDPCLKKQFRIRALERPSQFGGESCTE
SLVESRTCVPSKRCKIEQLDCKKKFKCATNRCIPLNLRCNGDNDCGDNSDERGCRKKVQR
IYENIPGVQLMGNGFNILSGESRGEVLDNTFFGGKMDIISGNGTAQNRKLYRLPANIDTF
RFNVQLAYERNDTVSATLHKSLIPFSRENQRHGASSGRGYSSSGIFLLWHTGTSSRSWSS
SSFREAVSATKQKNSNFIRINKVISVSDFTMKKNNLWLSDVFLKALNNLPLEYNYPLYSR
IFDDFGTHYITEGSMGGSYDLLFQYSAEDLQSSGLTDEQAVYCIVTEIRRQKFFFFFETE
VKHSCTTNRMTERYSGSFLQSSEKSISFVKGGRAEFAAKLAWQKQGASPDEKVFTEWVAS
TVDNPDVVEYKLAPILDIITGIPCAVTKRRNLLRAFATYMEKFDPCICAVCPNNGRAFLS
GTECLCICQPGTYGDNCEKRAPDYTSVVVDGAWGCWKAWSSCDGALTRRRTRECNNPCPR
NGGKPCEGEATQEEDCNISLFEDTGALCINDGEDKKEVDLEQPEHDSGCSSPELPENTYI
INEKKWYSVAEEVELQCVSGYELSGYQFLRCLPDGTWRQEDVECVRITCSRPETSENVNI
IYYKKEYKVGESIEIICPSGFISSGQRKYTCESSLEWNPPVVGQLSCIEDPHKAIQGNCN
QGQKKTGSECECMSPGTDCGHSPEDHCIFDTVAKEAVSMSRCKFLAENCLSTGRMHFLEK
GPCHNNKLDWYRTRVSLALNSTKKEPCGDDICYDWEECSEITGFECLCILPRQCPADSPQ
MFCAKFGRSKSQRSISLCALAAIKCTDIKVEVLHSGECDS
Download sequence
Identical sequences F6YX82
ENSXETP00000062218 ENSXETP00000062218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]