SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000062337 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSXETP00000062337
Domain Number - Region: 238-329
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000116
Family Calponin-homology domain, CH-domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000062337   Gene: ENSXETG00000002610   Transcript: ENSXETT00000063556
Sequence length 599
Comment pep:known scaffold:JGI_4.2:GL173421.1:123430:172209:1 gene:ENSXETG00000002610 transcript:ENSXETT00000063556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPVIKALDVYDVQQARISASLSWLIYRYYGKEVPAELCSPCYTDQYEQEHVKPAAIALL
LSADIYCRAYRRALPHDSSPPRDNAGLLLMLARKGLAPTNQGEPVKTSDLREKPIRMAAH
LALIDSLMTLYSIHCTAPLPPDAEISLTSVETKLLDWIDKVNNHLLDEAEREQGKKQMSA
PEGQNQAGCPSRWYWKLVPHAIAFCLKESGNKPPVIRYRKDKALSRQTPCFTAVSSLRDL
SNGSALAATVHYYCPAQLRLQDICLKDTMSVADSLYNLQLLREFYAQHLPPSCPLSLEDL
LYVPSALKVNLVALLADLYLCFEVAKPDFVQPKDVYLHSESATPSSAHSGGRSPVFNFNR
PGNTGSLPHSSSMSHMEGFGKAWVKNPLSHPLSQAVSFSIPFGLDSDVDIVMGNPVNIMR
SVSSDSLNPPAFPPKSPSCVSRATYTPPEDAAELRTLKKVPGKVTSDLNSQDKTAGSPGV
QSDLPTIEEALQIIHSSEARHLPDGAPDGFYLHSPEEAKPPKVEELVVTPNVGVYRTHNA
SRRLSRDDDSVLRDNSLDSDAEETKPAQDSSRSSLSSQADSSTGPGTKMTSFAEKKKKI
Download sequence
Identical sequences F6SSZ7
ENSXETP00000062337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]