SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000062340 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000062340
Domain Number 1 Region: 2073-2232
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.49e-35
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.002
Further Details:      
 
Domain Number 2 Region: 2545-2602
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 9.02e-16
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 3 Region: 3171-3228
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000262
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 4 Region: 4252-4302
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000034
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 5 Region: 3803-3861
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000129
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 6 Region: 4005-4056
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000654
Family TSP-1 type 1 repeat 0.00042
Further Details:      
 
Domain Number 7 Region: 2707-2758
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000144
Family TSP-1 type 1 repeat 0.00079
Further Details:      
 
Domain Number 8 Region: 2973-3031
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000405
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 9 Region: 3227-3285
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000641
Family TSP-1 type 1 repeat 0.00063
Further Details:      
 
Domain Number 10 Region: 4806-4863
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000131
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 11 Region: 3944-4003
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000107
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 12 Region: 1273-1336
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000157
Family ATI-like 0.08
Further Details:      
 
Domain Number 13 Region: 1699-1748
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000183
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 14 Region: 4600-4654
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000222
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 15 Region: 4757-4807
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000249
Family TSP-1 type 1 repeat 0.00094
Further Details:      
 
Domain Number 16 Region: 1411-1452
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 17 Region: 3632-3678
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000575
Family TSP-1 type 1 repeat 0.00083
Further Details:      
 
Domain Number 18 Region: 1491-1530
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000117
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 19 Region: 4156-4211
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 20 Region: 1561-1598
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 21 Region: 2393-2432
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 22 Region: 4313-4364
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000458
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 23 Region: 820-885
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000474
Family BSTI 0.082
Further Details:      
 
Domain Number 24 Region: 2492-2545
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000667
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 25 Region: 464-526
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000114
Family BSTI 0.082
Further Details:      
 
Domain Number 26 Region: 2455-2491
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000117
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 27 Region: 2767-2826
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 28 Region: 2243-2281
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 29 Region: 1374-1412
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 30 Region: 3453-3501
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 31 Region: 3383-3428
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000249
Family TSP-1 type 1 repeat 0.00082
Further Details:      
 
Domain Number 32 Region: 1816-1878
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000249
Family ATI-like 0.067
Further Details:      
 
Domain Number 33 Region: 1451-1486
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 34 Region: 4972-5037
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000429
Family VWC domain 0.033
Further Details:      
 
Domain Number 35 Region: 3081-3136
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000785
Family ATI-like 0.075
Further Details:      
 
Domain Number 36 Region: 3035-3075
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000011
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 37 Region: 2877-2939
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000235
Family BSTI 0.047
Further Details:      
 
Domain Number 38 Region: 3880-3933
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000353
Family TSP-1 type 1 repeat 0.00093
Further Details:      
 
Domain Number 39 Region: 1914-1972
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000458
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 40 Region: 4421-4478
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000994
Family ATI-like 0.028
Further Details:      
 
Domain Number 41 Region: 1600-1636
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000113
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 42 Region: 4060-4119
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000147
Family ATI-like 0.066
Further Details:      
 
Domain Number 43 Region: 3295-3344
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000245
Family BSTI 0.052
Further Details:      
 
Domain Number 44 Region: 875-941
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000262
Family Fibronectin type I module 0.05
Further Details:      
 
Domain Number 45 Region: 975-1025
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000439
Family VWC domain 0.056
Further Details:      
 
Domain Number 46 Region: 4667-4717
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000471
Family ATI-like 0.092
Further Details:      
 
Domain Number 47 Region: 1754-1794
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000628
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 48 Region: 4111-4177
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000753
Family VWC domain 0.095
Further Details:      
 
Domain Number 49 Region: 3510-3566
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000105
Family BSTI 0.039
Further Details:      
 
Domain Number 50 Region: 4924-4990
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000589
Family ATI-like 0.012
Further Details:      
 
Domain Number 51 Region: 2606-2668
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000085
Family ATI-like 0.071
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000062340
Domain Number - Region: 1658-1687
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00017
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number - Region: 4209-4270
Classification Level Classification E-value
Superfamily FnI-like domain 0.000178
Family VWC domain 0.074
Further Details:      
 
Domain Number - Region: 4363-4417
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000222
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number - Region: 3681-3739
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000314
Family BSTI 0.024
Further Details:      
 
Domain Number - Region: 2668-2725
Classification Level Classification E-value
Superfamily FnI-like domain 0.000513
Family VWC domain 0.05
Further Details:      
 
Domain Number - Region: 5045-5135
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.0022
Family Gonadodropin/Follitropin 0.023
Further Details:      
 
Domain Number - Region: 4523-4594
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00929
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number - Region: 524-565
Classification Level Classification E-value
Superfamily FnI-like domain 0.0146
Family Fibronectin type I module 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000062340   Gene: ENSXETG00000032528   Transcript: ENSXETT00000065044
Sequence length 5141
Comment pep:novel scaffold:JGI_4.2:GL173667.1:34653:114739:-1 gene:ENSXETG00000032528 transcript:ENSXETT00000065044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEAPSLNFMEFSPILMRWCEQMVQVTEEQVVSPRREQVVPCSNVFQYNLEGWQLDQEQMR
REYGGDAGIARYYLERGAASMCFIYKPQDTRAVVSNRTIRACCEGWSGAHCTEGQGFLGR
CFPSWNCQDSLHPQNVSLMSMEECCSHPWGHSWKNITSDFCFSCSYVSPTVDPASPYLMR
PYFSTALVGVSPQQRRLFSTCVTWGGFHFRTFDGKHFHFHGTCTYTLASSLDSTWAVYIS
EELCPQPAQCPKTLEVTLGLERVTVRRREVSVNGVTVPEGVPHLQNGINILWLGDFLFIE
SGLGVRVKFDGRNNVYVTVTLDQRGRTRGLCGVYNEDPQDDFTEVGGNVSPHAAGFANSW
RIQDSNTQGTCEDAAETGHSCDVPGREAIRGEAETICRKLLSSPFTQCHPKVDPSGYYET
CMYTYCQHSGGASDRAGAVCETFTSYARECAQQKIIIDWRRAGFCEKKCPNGKEYSDCMS
SCPASCAAVGSYEDGQCRDECVSGCECPAGLYLEQGVCVKEEECPCFHRRQRYSPGDTIK
QRCNQCVCRGGRWHCTQDKCAAQCSVVGDPHYVTFDRKRYSFHGTCDYILVQDYVDGKLL
ITAENVACGSKGSVSCLRAITVTAHKTSIRLSTKGDYTVNGREVTLPFLSPDLSVRWVSS
SFLLLQTFGAYVLWSLEFPAAHITLQPVFSNKVRGLCGTFNWNQNDDFTTPEGDIETSSF
SFANKFKVSAECPDVGPFTFDPCGTYAQRREFAEEACAVILSPVFQACHDLVEWEPFHQL
CLYDVCGCAPNKNCLCSAVSAYARQCAQEGAIMSWRNQTFCPVQCTGGQMYMECTPPCRK
TCADLRMAGTGSCQELEGCVAGCNCPEGLVLDESGQCVPPNMCQCHHGAETHQPGSKIQQ
NCKSCVCENGVWNCTGSSCPEAAYCPGNMVYSPGSCLLTCDSLERNGTCSDTLDGCVCPE
GTALLKDSCVLPEDCPCHHHGKLYHPNDTIVKDCNTCVCKNRHWSCTDLQCSGVCTATGD
PHYVTFDGRSFTFLGDCQYVLARENGGLFTVTAENVPCGTSGITCTKSVVVMIGNMIVHM
LRGKEVTINGISVRPPKIYSGNGITLERAGLFTMFISQMGLTVLWDGGTRVYVKLDPAFR
GRVSGLCGNFDGDTENDFTSRQGIVEPTADLFGNSWRMSLMCPEVNADDFEHPCTENSHR
VTWARKKCGVLLQSLFAACHQEVPCQQYYDWCVYDTCGCDSGGDCECLCTAIATYAEQCN
QRGVYIRWRTQDLCPMQCDNGMVYEACGPACPQTCKNLGLAPDPHCNSLSCVEGCFCPAG
KVLHEGRCLDPSDCPCYWGGMPFPTGAAIKHGCKNCTCEAGKWQCPTEPCSSPSHCADNE
FACHLSERCVPNAWVCDNEDDCGDGSDEWSCPAPSCGSNEFRCSNGRCIPIAHHCDGHDD
CGDFSDERGCYCDVGEFQCPDGLCIPREKLCDGEKDCPRGTDELLCTGAGTCSEGRWACG
DGLCIGRDKLCDGEPDCGDGSDELQAQCATAVPQPGGSVGSDSTEATGPTGPTQSSLCPS
GHPCGRYEFQCGSGECRPRGWLCDNEVDCRDGSDEQNCNRTCGLDQFKCTLSGECVGYGQ
LCDGIPHCRDQSDESTDNCERSPVTISPTGPKNQTVPACSEYSCSDGRCLLFKQVCNGIT
DCDDGDEASGWVASDEKDCGFWSPWGSWSECSHSCGTGMQSRRRTCTNPSTDVLRQCRGE
EHETQQCFTVSCPVDGSWTPWATWSNCTQDCTGIVIRRRECNLPQNGGRHCSELPDSSAS
SLEIDVCRQDGCPQTPSCSADLEFRECAPCPLTCSDLSNKRTCPQNPTCASVPPGCFCPE
GLLLDSLNHCVRPEQCPCEVEGATYWPGQLVKVNCQICTCQDGQMKQCRQNPECNVHCGW
SAWSPWGECLGPCGVQSIQWSFRSPNNPSKHGNGKQCRGIYRKARRCQTEPCEACSYQGK
SQSIGERWRSGECHVCQCLPNLTVQCSHFCQYTNHGCPEGQYLVEGHGDTCCYCSETAPN
GTEVSWPPPTSLPATTPVPALITYPLPAVGDECYKPLKTSLLPDSSFISSSQQSENPAHA
GRLNNVSPRSLFQGWSPQEHEYDGLPSSSSFLQIDLQQPWNLTGIVVQGAGAQDAYVTSF
SVQFSMDGNNWHEYKEMTNGQEQTPKPPPGNFDGSTPVARSFERIIKARYVRILPQHFHG
GVYLRTELLGCGTAPSPLPPAKWGCQKSQYYCKSSGNCIEASQRCDGRQDCSDGADEFGC
VSWSHSTTSSSENNPADAGRLDIVPREGISDTPEQNLKPGSQKPGVFPTGSPGLPEMGTE
GTLFPTLRTASLGPGEPGMRPVKPELISVPEGHHASLKPEPSGGPGASMSTLFPRIPCSV
GQFACSTFGCVDSSFVCDGQEDCIDGSDEYHCGNMTIIVPTTHPTLWPTLSPGASLCSAR
QFACASGECLAMERRCDLHRDCADGSDEDKCADCILSPWTFWSDCSRTCGLGVTFRRRDV
IRERQPGGHCDEAQFDSKSCFVQACPVNGAWSPWGDWSPCDAECQGGVRSRKRSCEDPPP
KNGGLPCRGEAVQTESCNLQPCGDTLDCGPEMIYVNASDCEPLRLDACPQTCRGLNAETL
CNSSCMAGCRCPQGLFLQNGTCENISRCLCHTDHGSQATGETFSGDNCTVCHCKDGKINC
DESDCPVNCGWSAWSHWTPCDRTCGSGVQERFRSPTNPPSANGGAPCDGDTREVRECFSS
CDNVTETDRMWGEWTPWSACSKTCVYDVEHLGVRRRFRHCNNSLASSTSPCVGESVQEEA
CDTPLCPGERLERQALGVSCLPLVALIGSSPGFPTSGPLWGSCFSYRTISGFPPTELCPE
NMIYQTAEQCWSGGGACPRLCLDQAALVECTSACYEGCYCPEGLFLQNNSCLPQSECPCY
HQGAIYQPGENATLDGCNNCTCAAGEMLCGQEPCPVDCGWSTWTTWSSCSRTCNVGTRRR
YRSGTNPPPANGGRGCEGSNVDIEFCSLQSCRGSAGEWSPWSECSVPCGGGYRNRSRSGV
VLRRIEFSTCNLRPCSGEAPGVCPDGKVWKECGDGPSSCADLSSETTNGSCQPGCYCHHG
EVLLNNLCVPTAACPCTEDGALYEAGETVPRGCNNCTCLSGQISNCTQLGCEVDGNWSDW
TPWSECSSTCGGGFQTRYRFCDDPPPSGTGLPCQGPDREEQPCSVEPCSEGGNWSQWSSW
TDCTKTCGEGVKMRSRTCDSPLPLGEGNYCEGPSSEIMPCHLAECPEANCSAILGSVFSS
CGPPCPRTCDDITHCMWRCQPGCYCPNGQVLSENGTACVDVEECTCLDIISGRRYLPGEM
VPHRDGCNNCTCLNGTLSCTKEPCVVAGGWCDWSSWTPCSKTCGTEMVTRYRSCACPKPK
QGGDQCQGVQQYYGDTGVQLERKECPSSTFCPVNGNWGSWSPWSYCDGCTGESIRTRQCN
NPPARFGGAPCQGEARQSQGCQDNSTTCSDCGGGQVSFPCGRRCPRSCEDLQEDTMCMDS
PGCQATCGCPDGQLMQNGTCVEPSECRCKYQNRSLEASEPGNSSSWSGPIPWEYALPGET
VSGPCQNCTCTAGRLLCTPDPSCRLDGKWEQESWGPWSSWSPCSVSCGGGEQIRVRECQQ
DECEGKAIQSKSCNGQVCLDVGCPPGRLYRECENGDGCPYSCAHLTQQVECFSDGCEEGC
HCPVGTYIHNSSCVTECPCVMTEEIVQRFRNHSSNPNVTPIPLTDRGIQILVGEEVMPGE
KVQHECRMNTCENGWMNCTFSACPVHGAFTPWSPWSPCSVSCGGLGNMTRTRHCTNPAPA
NGGRNCEGPSMDIKYCQTPECEDITSPTVEPFPDITGSPEEGGYGPWSSWTPCSKSCSDN
EYPAMKTRSRFCLGGRNCTGESYQERACNLPQCTDSPLCEGEDCRQRNCSWNPWSEWSEC
SWTCGVGQQTRLRTYNPPGANGSWCENIMTGNMERRFCNLQACKVDGSWSKWSPWSWCDR
TCGGGRSIRSRTCTSPPPKNGGKECPGEKYHVRICNPKPCDEGCLPGMEHVECANKCPRH
CSDYQQGIVCQNGELCEAGCRCPEGLLEQDGVCVPVSHCECTDTQGQSWTPGSSLQEDCN
NCTCLNGHLVCTNNTCPRLDCQWSQWSKWSQCSVTCGSGTQSRFRSSTSGSPKRECQVPE
KQSRPCYPGMCPELCPHNGTNRRIGDAWLAGECQQCICTPEGNYCQDVECRVDGNWTPWS
PWSDCQVTCGPGIQIRTRACINPPPRNNGSDCVGPDTETQGCSNRPCEGSGLCDWSDWSP
CSKPCGTGLRSRTWRCDCPVPESPDVPCNTTEIVETAACYIQPCQGSCLWGPWSEWTNCS
CHSLLQHRFRDQKGLTFRGDGCEELGTESRLCNLSDCSESSCLPPFEFNPCGSPCEGLCS
SRHQPEICRDAPRCQAGCYCPRGMLEQNGHCVPRSECGCVYVPPTDSATSPETLFLPPGQ
TVRLGCRECMCQQGELQCDRTNCHEEALLSEWSEWSPCSPCLPSAPFSLQNASVTPAMFS
VQQRHRLCLSSHTGFPWSGPSAACIGELTQERDCPDKGVCEDLCVWSPWGEWSPCREPCS
GGFRVRWRHVYHPVGGKLCQGPRFQSQSCNTAACPGEECEDRGKAFKMSCANQCPRACTD
LWEHVECLQGQCRTGCRCPDGWLLQDKRCVPISDCRCGMPTADATIEYEPGDEVRVDCNN
CTCLNGTFTCTNLSCPSYGTWTEWSTCSVSCGGGHRHRSRMCSQEEPDGVPCGSETKEVE
ECNTLPCPADCELSEWSEWSECSASCGGGISERKRMVLVLGDLSGNPCPAPLLLHRSCNS
HNCTPVCSAAQGVGIPSGLNSVSPKQAHLSPRSQGFPWHQEHKGVCHMGAFSCTQDNCND
CPEGESWRRPSLGTELCERTCQEMYGDPQRNCSGSGGCVCEPGRYRSISGPCVTAAHCEC
EHQGQIYLPGTEWQDGCETCRCVNGLRECTAGCPPLHCLEGEVKVQEPGECCPVCRREIQ
DEPTAICQLHKEMRNITKGPCHLDQVEVSFCRGQCLSWTNVLPEEPYLQTVCDCCSYRLD
PVSPVRILNLQCEDGETEPVVLPVIHSCECSSCQGGDFSKR
Download sequence
Identical sequences F6SSQ4
ENSXETP00000062340 ENSXETP00000062340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]