SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000062395 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000062395
Domain Number 1 Region: 104-266
Classification Level Classification E-value
Superfamily C-type lectin-like 5.31e-19
Family C-type lectin domain 0.0054
Further Details:      
 
Domain Number 2 Region: 25-67
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000484
Family LDL receptor-like module 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000062395
Domain Number - Region: 265-330
Classification Level Classification E-value
Superfamily FnI-like domain 0.000314
Family VWC domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000062395   Gene: ENSXETG00000022386   Transcript: ENSXETT00000065017
Sequence length 554
Comment pep:known scaffold:JGI_4.2:GL172648.1:4028636:4050988:1 gene:ENSXETG00000022386 transcript:ENSXETT00000065017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPKPDSGTFLLLFLLVLTLTEPLRPELRCTPGQFACHSGTIQCIPLHWQCDGWPACEDE
SDEVNCPGLSGDQRTYHGKESVDTRFNRGRSGETPRFHTVNFAQPVRFSSFLGKCPSGWH
HYEGTASCYKVYSSGENYWDAVQTCQKVNGSLATFTTDQELKFILAQEWDMEERPYGRKD
QRRLWVGYQFVITSRNHSMEGHWEVAYKGSAEVFLPPVPIFGTAMSDNENILCAQLQCFH
LPSLRHLGLHSWYAENCYEKSSFLCKRSQTCVDIKDNIVDEGYYFTPKGDDPCLSCTCHN
GEPEMCVAALCERPQGCQQYRKDPKECCKFTCLDPEDGSSLFDSMASGMRLIVSCISSFL
ILSLLLFMVHRLRQRRRERIESLIGANLHHFNLGRRMPGFDYGPDGFGTGLTPLHLSDDG
EGGAFHFHEPPPPYTAYKYSDIQHPDDPPPPYEASISPDIILCSTPSDQGAHELIDAALR
PLYPFDSNASTPQTTEEPLPPAVLCLAQSQSDTTCSGDVSSSLLVPPKSLQNEAFTSDTQ
SGPSPSNCSLNTVV
Download sequence
Identical sequences F6S0E9
ENSXETP00000062395 ENSXETP00000062395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]