SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000062400 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSXETP00000062400
Domain Number - Region: 139-255
Classification Level Classification E-value
Superfamily YWTD domain 0.00288
Family YWTD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000062400   Gene: ENSXETG00000032730   Transcript: ENSXETT00000061041
Sequence length 264
Comment pep:known scaffold:JGI_4.2:GL172742.1:1152095:1155612:1 gene:ENSXETG00000032730 transcript:ENSXETT00000061041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKMLRFICLSLLGAIVSAGHSCTPFLASLVQLDAGDGMVLGVSESGHVFNWTGNDFLLVP
GQQLAHVTVGPAGIWGVGKDNVVYKLLGNQWKTITGGTLKQADAGGNTFLSGVNTKNNAV
CLNWGFTTSKYTAVSFSTMDGSFIYYSCGLLGCWALSSDSNNNVFYRQNVDEMDCQGNSW
IQVNGNMTMTKIEAGTDGSVFGVDSGGNLYRRLGISRNNPTGTRWHPLNYPLYISHATYD
SGTLWCLTPNGVVFRCQVSGSGLV
Download sequence
Identical sequences F7BF62
ENSXETP00000062400 ENSXETP00000062400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]