SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000062635 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000062635
Domain Number 1 Region: 169-369
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.47e-53
Family Prokaryotic proteases 0.000000559
Further Details:      
 
Domain Number 2 Region: 384-479
Classification Level Classification E-value
Superfamily PDZ domain-like 7.1e-20
Family HtrA-like serine proteases 0.0014
Further Details:      
 
Domain Number 3 Region: 40-117
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000361
Family Growth factor receptor domain 0.0016
Further Details:      
 
Domain Number 4 Region: 103-149
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000108
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000062635   Gene: ENSXETG00000032274   Transcript: ENSXETT00000061146
Sequence length 482
Comment pep:known_by_projection scaffold:JGI_4.2:GL173029.1:187193:207598:-1 gene:ENSXETG00000032274 transcript:ENSXETT00000061146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETPQLSELPISLLLRMKLCAWLPLCALLTLLSGATRTGACPARCDVSRCPSPICPSGYVP
DRCNCCLICAAGEGEPCGREGDPPCGDSLQCKPPPGMRGLKGSCQCKHTNPVCANDGQTY
DNLCQLKAASRRALQKGHSPVVLVQKGACQSASIGHQHPNSPRYKFNFIADVVEKIAPAV
VHIELFLRHPLFGRNVPLSSGSGFIISDLGLIVTNAHVVSSSNTVSGRQYLKVQLHNGDS
YEATIKDIDKKSDIATIKIYPRKKLPVLLLGHSADLRPGEFVVAIGSPFALQNTVTTGIV
STAQRDGKELGLRDSDMDYVQTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGISFAIPS
DRITKFMTESQDKKYKANNDGKKRFIGIKMLTITPSFAEEKKLHNPDFPDVTSGIYVHEV
VPNSPAQRGGIQDGDIIVKVNGRPLVTSGDLHEAVMNESPLLLEVRRGNDDMLFNLEPEV
SM
Download sequence
Identical sequences F7BZX9
ENSXETP00000062635 ENSXETP00000062635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]