SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000063066 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000063066
Domain Number 1 Region: 2-176
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.18e-67
Family Calponin-homology domain, CH-domain 0.000000909
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000063066   Gene: ENSXETG00000029995   Transcript: ENSXETT00000065031
Sequence length 226
Comment pep:known scaffold:JGI_4.2:GL172884.1:966399:1007329:-1 gene:ENSXETG00000029995 transcript:ENSXETT00000065031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQ
DISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLI
DFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKM
KALAVEGKRIGKVLDNAIETEKMIERYPQYFFCAKCAWKCLWHPKR
Download sequence
Identical sequences F7CK41
ENSXETP00000063066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]