SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000063508 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000063508
Domain Number 1 Region: 554-620
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000306
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 26-74
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000017
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 3 Region: 481-529
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000379
Family TSP-1 type 1 repeat 0.00073
Further Details:      
 
Domain Number 4 Region: 610-666
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000459
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000063508
Domain Number - Region: 79-123
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00133
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000063508   Gene: ENSXETG00000033440   Transcript: ENSXETT00000060490
Sequence length 824
Comment pep:known_by_projection scaffold:JGI_4.2:GL173201.1:523104:557074:1 gene:ENSXETG00000033440 transcript:ENSXETT00000060490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRVMSLLVYGDITSGFASQGSSVAPVHCKWSEFGSWSDCDGCSKTQTRRRTVEVYAQFGG
LECSGSAYETQPCVPTRGCPIEDGCGDRFRCSSVPLGQCISTSLVCNGDHDCEEDSLDEH
QCTVLHKVCDIDKYPPNTELTGLGYVTETSQFYLRHIEFLQPGGFITPCKNIKQYIVYMG
LYSIKMNLPFNELKNEMFGYFAGTNRSSLQSAAEPPSYRSSSSIGKHEGKEYKMCLISSP
HPIETSQFYLRHNIFQSLGASYTKNVVTMPSLGSYQKCHHRWDWGARREREIGGLGERWR
VLGLTLTHSVTITDMQSCTSKSTGFLFFHHSSTECKKLNEVIKQSSGSSGREVRGDVFAQ
GGEAKFVAGLSSFSLDNPQANENRYASWAGSVSNLPSVIKHKTTPLYELVKEVPCASVKK
HYLKRAIEEYMSEESPCRCKPCKNKGVPGVEGTQCVCYCKPSTYGPACQYGVLVEGDPAV
VDGSWSCWSAWSLCLSGSRRRVRNRVCNNPAPSGGGLKCIGDSIESQQCEDSELEHLRTV
EPHCFDISIVPTEFCPPAPLLENGFIQDSNPPYPAGRRIVYTCKEGYAMVGDPIAQCGED
LKWQTGQMRCQQIMCSPPVLPGIVTFVPEKDAYEIGDKISLSCSFGLDLEGPHTISCTSS
LTWLPSINNIDCSAKATPTTAQSVRSQCQPWEKFEDGKCSCRMPYECGASLDVCAVDGRN
NKNIALTLCKMHALLCLGRKYTLTSDAKCKFPAAAERSCDSCYPWEQCKAQTKKCVCGEA
ETCANEGISICVNVNGKLQTMSECEAAIRKCQGENAIIVSISPC
Download sequence
Identical sequences F7EHA6
ENSXETP00000063508 ENSXETP00000063508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]