SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000063654 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000063654
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.95e-34
Family Calponin-homology domain, CH-domain 0.0000432
Further Details:      
 
Domain Number 2 Region: 182-213
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000586
Family LIM domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000063654
Domain Number - Region: 214-242
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000244
Family LIM domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000063654   Gene: ENSXETG00000018105   Transcript: ENSXETT00000066242
Sequence length 1017
Comment pep:known scaffold:JGI_4.2:GL173537.1:37297:80107:-1 gene:ENSXETG00000018105 transcript:ENSXETT00000066242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAIKALQQWCKQQCDGYRDVSITNMTTSFRDGLAFCAILHKHRPDLINFDLLSKENVYD
NNHMAFSVAEEKLGIPALLDAEDMVKLRVPDRLSILTYVSQYYNYFHGRSPIGGLAGVKR
PPPDTVEEPAGKKVTNDVLPTPQATSRAPQPVPRTNVPVLKSNTVIENPPVRAGIREIDS
NSSVSSNCMICGKHVHLVQRHMADGKLYHRNCFKCKQCSRTLQPGQYKAGDGLGSFICTN
HHIAVPTSPVTRTIMPAAPHGATVDEKKSSWVTPSNNQKLQHSTGAPAQEDKPSRNILNS
PYSSSSTSTAVGFGNSIKDNSSTITIGSNQQNKVDNNYLNTSRSVAHEQPKKPSSDLLTH
KGKSEPQKDPLPSNQQIKSPNFTINSISAGRMTTLVTKDEPKETSPKPWELSAAKNKAAR
ERFFQTSPAVVEPANKVSSRDVVSPKSSDGPGKSTASSLSPGITDSSTEKDNARNYLLKT
LGGPTSPKPSGINVPVSLYKPKGVLFPLSEAIKVYKYSLSAKLPVVYSITGTDVPRLLNE
KTADPSNSSTKVEPARPVPKERKNKNDTAKAVLNPEPLLTTPTYSSKGITTPSTGNSSST
TKGITTPSSGNSSSTTKGISTPITGSSSSTTKGITTPSSGNSSSTTKGISTPITGNGSST
TKSYLSKSGPGQRAEEISSKGPVPNSNVSKQETPENWRQNLKPIAKTPQTPGSLVSKKPV
LLRTRLSDYPTPIKPMKSGYSGAEVTLCSVVQPKVYPLPKDDGWGSASSSPTPPRKKLLP
VNLDLINDWPKPVQKWQDVSLKDDTKRPAVTGSPCRYLTAHSSVNERNSAPPSISEYINA
RPEYIPEEEIQRQLQIIEQELDALEQQGVEMEKQLRSCDGDESEDTLMVDWFKLIHEKQL
LLRQESELNYISKQQALEDKQSNVDTELRNLMNKPDDLKTPADREREKQLLDQLLVIVND
RSGIVECLDEDRIRREKEEDEIMEAMIQRHSGKKQVEGGVYVSVLSVSRESSKGGQS
Download sequence
Identical sequences F7DD58
ENSXETP00000063654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]