SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000063667 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000063667
Domain Number 1 Region: 226-297
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.7e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 348-418
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000181
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 3 Region: 286-344
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000751
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 408-467
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000139
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 5 Region: 123-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000958
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 6 Region: 173-210
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000174
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 70-111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000218
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000063667
Domain Number - Region: 38-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00355
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000063667   Gene: ENSXETG00000002215   Transcript: ENSXETT00000063044
Sequence length 911
Comment pep:known scaffold:JGI_4.2:GL172865.1:949113:1000685:-1 gene:ENSXETG00000002215 transcript:ENSXETT00000063044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEGIVLLLVLPLCLALALPCHAQLQDDASGQDVCKKCHTNATCLERNKKYSCICNYGL
IGNGRTHCLDKDECQIGSYKICGNHTACHNTHGSFFCVCLDGYRPSNNHKHFIPNDGTFC
TGTDIDECESADICGYKGKCKNIPGSYECYCMDGYQLKNGTEPFQANSDNGCVDVDECEA
EDICGHNAKCRNVPGNHECYCMEGYRLNNGTEPFQAHSRMNLCSVIDCGQPPALLHSQMN
LEGNTTFGSQVTYRCDAGFTATAGRAMSICTSNGTWEGASLVCTVIDCGFPPVVPNALIN
SSDNTTFGSNVTYTCMKGYVASSGYGFARCAQNGKWEAATLSCQDTVVDCGQPPSIQHTS
SKFARNTTLGNTIAYECMSGYVKQSGNGIAVCNEDGEWDGADLICKEINCGLPPPVPNTQ
VILSGTTNLGSEVEYKCVHGYYNPGNRSVSRCTLNEKWEEVNVTCKVIGILIGNVTVFNE
TCLRWRKSSEIIDWEILYKFSILGKGWHQIHYVHEKDFKLLTNNSFQCLDLLPGNNYLVI
MRAVFPEMQEISINITLETAMIKRFGDITLFNTTCLQWTKSSGKNEELEEYTVLIKGQVW
KPPKISLNIMFNFSTSSRNPVLCLMLPPEEEYIVNVTESSTGLSSSIPFRTLGHDSEDVS
GTAPLGETCLQWNRSIEENGVQEIYRIHVQEAQGQPKPNPQLLLFNISTDQGTSQVCFKI
ATDQQQLNMTEAPSPPEANTTRELADTPLPKVQFVSKYGQLPKVSIQKTDQHAPFSSYQV
FVKHSGPLCSFTCDSLEAVPYFHNISKTRAYVTAEFSPSDIPEVLEFSLGDRQYYGEFYN
APLAQEKDYCIILRIISRWDRRIPATILIKRVRSSFTPSRNYMNIVLPGSVAFVWFIIFL
SYSAARCCKRR
Download sequence
Identical sequences F7DCN6
ENSXETP00000063667 ENSXETP00000063667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]