SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000063707 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000063707
Domain Number 1 Region: 514-559
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000458
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 2 Region: 61-102
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000087
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 10-57
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000405
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000063707
Domain Number - Region: 468-507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000628
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000063707   Gene: ENSXETG00000011135   Transcript: ENSXETT00000065814
Sequence length 559
Comment pep:known scaffold:JGI_4.2:GL172640.1:3014762:3026792:1 gene:ENSXETG00000011135 transcript:ENSXETT00000065814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSIAAPQPEDCQLDQWSQWTSCFPCQQKKYRYRKLLQPAKYEGRPCVGSLWASMACQTAQ
KCVPENNCGNDFQCRDSGRCIKRRLVCNGDLDCRDSSDEEDCDAPEHETFCKTLFPIPGA
EKSVRGINILTHEDTRNVIDHNYFGGQCEYIYNGEWRELRYEPVCEQMYYSDEEKYFRKP
YNFHIYQFLARADTKMSIEIYEDSKDVVNAVKRDFSFNIGLTFGISVPEAPVGLELGLNY
GLKTSFLKKITSFNQKNLEFVRMVTKIQTARFKMRRNLLTLDEDTMQSLMELPDEYNYGL
YAQFINDFGTHTTTEYFVQKNINYISVVYYCRMHFYYLITASMVSHCFGASVGLSVQTEF
EEIIPSLKLSGDFCTKFERENQDNSSSSRAIKDVITYVIGGDSGSAGGILNVFDGRMYRY
WGRSLKYNPAVIDFEIQPIYEGLQQTGLSGIEAKRQNLKRAYNEYLSEFDPCRCGPCHNN
GMPMLENNVCTCLCTAGFNGPSCENTLRKDVKADGRWSCWSPWTQCQSGKRQRTRECNNP
APKNGGAWCLGKSLQSEPC
Download sequence
Identical sequences F7CG00
ENSXETP00000063707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]