SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000063714 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000063714
Domain Number 1 Region: 61-243
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.74e-39
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.027
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000063714
Domain Number - Region: 2-27
Classification Level Classification E-value
Superfamily WWE domain 0.0628
Family WWE domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000063714   Gene: ENSXETG00000032370   Transcript: ENSXETT00000061300
Sequence length 243
Comment pep:novel scaffold:JGI_4.2:GL173311.1:457909:459406:-1 gene:ENSXETG00000032370 transcript:ENSXETT00000061300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFSLHLAMMYQVNKDTGRKRRMRKRPLFRFVPCIILNDQSDLGSLCPKSWFVSNALLIYE
KVPLTCHHREFFHIYQYFHSTMPESTYRISEISRIQNYFQWERYSRKRAHMRQSGDERLL
ERHLFHGTDPGSVEAICRQNFDPRVSGKNGAVYGQGCYFARDASNSHKFTRGSLQGHHFM
FLAKVLVGRPALGHESFRRPPQITPDDPCSPLYDSCVSCNWDPSIFVIFDNDQCFPYFLI
KYQ
Download sequence
Identical sequences F7CFL5
ENSXETP00000063714 ENSXETP00000063714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]