SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000064061 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000064061
Domain Number 1 Region: 32-272
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.87e-85
Family Calponin-homology domain, CH-domain 0.0000103
Further Details:      
 
Domain Number 2 Region: 298-419
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-32
Family Spectrin repeat 0.0000828
Further Details:      
 
Domain Number 3 Region: 604-742
Classification Level Classification E-value
Superfamily Spectrin repeat 7.64e-29
Family Spectrin repeat 0.00049
Further Details:      
 
Domain Number 4 Region: 1644-1797
Classification Level Classification E-value
Superfamily Spectrin repeat 1.82e-28
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 2182-2291
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-27
Family Pleckstrin-homology domain (PH domain) 0.0000505
Further Details:      
 
Domain Number 6 Region: 1855-2009
Classification Level Classification E-value
Superfamily Spectrin repeat 1.24e-27
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 7 Region: 906-1060
Classification Level Classification E-value
Superfamily Spectrin repeat 2.44e-26
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 8 Region: 1231-1378
Classification Level Classification E-value
Superfamily Spectrin repeat 4.25e-22
Family Spectrin repeat 0.00078
Further Details:      
 
Domain Number 9 Region: 429-529
Classification Level Classification E-value
Superfamily Spectrin repeat 5.5e-21
Family Spectrin repeat 0.00053
Further Details:      
 
Domain Number 10 Region: 532-639
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-18
Family Spectrin repeat 0.00052
Further Details:      
 
Domain Number 11 Region: 1062-1176
Classification Level Classification E-value
Superfamily Spectrin repeat 4.84e-18
Family Spectrin repeat 0.0000573
Further Details:      
 
Domain Number 12 Region: 748-850
Classification Level Classification E-value
Superfamily Spectrin repeat 3.31e-16
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 13 Region: 1351-1452
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-16
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 14 Region: 1478-1593
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000249
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 15 Region: 2015-2075
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000446
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000064061   Gene: ENSXETG00000032471   Transcript: ENSXETT00000063081
Sequence length 2331
Comment pep:known_by_projection scaffold:JGI_4.2:GL172882.1:1504553:1544955:1 gene:ENSXETG00000032471 transcript:ENSXETT00000063081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSSNMQTTDFDNLEIEQQYCTINSRWETVEDDLDNDNSSARMFERSRIKALADEREAVQK
KTFTKWVNSHLAFVSCRISDLYLDLRDGRMLIKLLEVLSGEQLPRRTKGRMRIHCLENVD
KALHFLKEQRVHLENIGPHDIVNGNHRLVLGLIWTIILRFQIQDIIIEMKGSETRSAKDA
LLLWCQMKTAGYPNVNVTNFTSSWRDGLAFNALIHKHRPDLFDFERMKKSNAKHNLEHAF
DTADHKLGITQLLDPEVSKIPNADENCIVTYIFNSIFKICKKIKVVYFEFSRFMQVLDNA
IETDKMIYEYESLTSDLLTWIEQTILALINRTFANSLTGVQQQLQAFSAYRTTEKPPKFQ
EKGYLEVLLFTIQSRMRENKQKVYVPQDGKLVSDINRAWGRLEKAEHDRETALRNELIRQ
EKLEQLAKRFDRKAAMRETWISENQHLIAQDNFGFDLPSVEAAKKKHEAIETDIYAYEER
IQALVNVAKELENERYHDIRRISARKDNIVRLWQYLLEILKSRRNRLNMTVELQTLFQEM
LHIVNWMDEIKGGLLSQDYGKHLLEVEYLLQKHSLTEADIAAQADKVKSFSQAALKFVGG
DGYQPCDPQVIKDRVQHLELCYQELVSLAAQRRHNLQQSRCLWKFFGDIEEVARWIREKE
QIYTSMDFGKDLTSISILQRKHRAFEDELKGLETNLQHTLKDGEQMIANKHYASPKIKEQ
IENIKVQWAQLKDLAAFRLKILCDTENFFQFQVDADDLAARMQDTYRMMQSDDVGHDEYS
TKILVKKQKDLLDDIMINRKVLEGLSEVVQRFPEEFKTSPEIDSRLQKLRALFSDLASLA
DLRSQKLQDALSFYTVLGDIDACEMWMNEKEKWLEKMEIPESLEDMGVVQHRFNTLDQEM
GALGSQIQDVNTAANALIESGHPSRKKVKEDLDHMNSRWTVFQEMVSQKRRAVDSALGLH
NYGVECDETKNWIIEKIKVVESIQDLGSDLASVMSIQRKLYGIERDLAAIEAKLINLQGD
AQKLANDHPDQAQNILDRLIDINKKWEELQKALQNQEESLGESSKVQKFLVDLFDFETWL
YRAQQATASEDIPTSLPEAEKLYANHLSLKDDIERHEPDFCDVVDTGNKVTSGQTDPQYE
QLDQRGNDIKEGWNDLHKMWDNREKSLSQCLEFQKFLKDAKQSEAILSNQEYTFAHIEVP
TTLQASQTRLKKHEDFLATMENNDEKIVGTINHGKKLDEDKNVFADKALGKISFIEERYA
KNLNKAKEVSILLKDNCDLQNFLENCEELNIWINEKMLTAQDTSYDGARNLHSKWLKHQA
FKAELDSNKERLENLDKEGKQLAQEKEQFAPIISEKLSELHRLWDELETTTLQKEQSLFD
AHRTELYEQRYADLNKWIKDMEQQVKSDDCGTDLTSVNILLNKHKRIEDQIQQKTIEMDQ
VLPQASALGKEPDEKEPEINVRFLQLEPLMQERKRKLLSSKQVHQLHRDLEDEIVSLTEI
IALECPHAKGYMSGTVQSYIHKGSTLQKEIAGHSPRIEDVLMRAKHIEHDADIDDQPIEK
KRKSLEESWDNLQKQIAEREKHLLQALEAHHYYMDAGEAEAWIDEQQLYLIGDEQPKKDE
ESVVAMLKKHLNLQHAVEHYGKNIKDLADQAQKLLALEHPDSERITRHQGNIEKQYAALR
DMADEKRQKLDNIYHMFQLRREVEDLEQWIAERDVKASSQEMGQDLDHVSILRDKFRDFA
RETGVIGQERIDNVNILIEQLIDAGHADAAMIAEWKDNLNESWADLLELIDTRVQLLSAS
YELHKFFYDGTEILSMIEEKHKELPEDLGGDVHTAQSLHRVHTAFERDIHFIGSQVQHFQ
DTAARLYAAYAGTQAVDIQKKEQEVVEAWKGLLDACDGRRTELISAAEKFRFFSMVRDLM
LWMENMIRQIETQEKPRDISSVEYLIKYHQELKAEIEARNVTYTACVDLGNTLLARNHPA
SEEIKEKLVQLEERREEMMEKWHKRWDWLSILLEVCQFARDASMAESWLISKEPYLYSTY
VGNSVDDVEKLIRRHESFEKSTLTWEERFSALERLTTLELLEVRKYQEAKRHEIFQTHEE
KEHEVKAIIHAAPDSPVLEELKPRLPSITEVTEETKEKEEEKITQEEYTHTESMEQTEYS
ILDPETRQIEATTLPTDSGSSSSIQHQGYLNRKHDLDGTLKKAANRSWNNVYCVLKNHDL
YFYKDAKCFALNEAFQGEGPLPLRNASCEIVADYKKKKHVFRLRLGDGNEWLFQAKDEAD
LQTWVPILATTITEATDHKPKSKSLPLPSTSASEGKPEKKDKRFTFFSSKK
Download sequence
Identical sequences F7AP31
ENSXETP00000064061 ENSXETP00000064061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]