SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000064118 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000064118
Domain Number 1 Region: 3-114
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-29
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 2 Region: 207-326
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000144
Family Spermadhesin, CUB domain 0.005
Further Details:      
 
Domain Number 3 Region: 402-440
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000916
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 4 Region: 122-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000262
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 5 Region: 167-208
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000105
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 6 Region: 363-400
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000484
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 7 Region: 325-362
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000877
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000064118   Gene: ENSXETG00000033897   Transcript: ENSXETT00000062299
Sequence length 579
Comment pep:known_by_projection scaffold:JGI_4.2:GL172806.1:1786585:1800414:-1 gene:ENSXETG00000033897 transcript:ENSXETT00000062299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AACSGKLEQHTERRGVIYSPAWPMNYPPTMNCSWYIQGDHGDVITISFKNFDIEDSHKCT
ADWLLIGPSSRREEYKVCGSAIPPAFTSSRDHVWIFFHSDATSSGQSQGFRLSYIKGKMG
QTSCPAEEFLCGNGKCIPNSWKCNFLDECGDNTDERNCTAPSAETHTSLCPVGTFACSAA
HSVQCLSNELRCNTVKDCSSGSDEENCPDLKCGGKLSNFYGSFASPDFFHADHSRTDLQC
TWYVDTQDNRHVILQISLQLGYNDYVRVYDGIGERSERLLHTLSYHNNKHTVLSESPNGQ
LTLLYHARSKSMGHGFNATYQVKGYCLPWEHPCGSDEVCYSDSQHCDGWWHCPNGKDEEN
CPACQMNEYPCEGGSGLCYSSSDRCNNQKNCPDGSDEKNCFTCQPGNFHCGTNLCIFETW
RCDGQEDCQDGSDEQNCLVIVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRSREYRA
FETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVFSDSQSSMLQNIRTAMRRQMRR
HSSRRISSRRRLGRLWNRLLHRPRARGQIPLLASILSQT
Download sequence
Identical sequences F6Y116
ENSXETP00000064118 ENSXETP00000064118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]