SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000000136 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000000136
Domain Number 1 Region: 350-513
Classification Level Classification E-value
Superfamily SPOC domain-like 9.42e-40
Family SPOC domain 0.00024
Further Details:      
 
Domain Number 2 Region: 9-162
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.45e-32
Family Canonical RBD 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000000136   Gene: ENSXETG00000000072   Transcript: ENSXETT00000000136
Sequence length 522
Comment pep:known scaffold:JGI_4.2:GL172795.1:1181532:1183100:1 gene:ENSXETG00000000072 transcript:ENSXETT00000000136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APEDDHRATRNLFIGNLDHMVSEVDLRRAFDKYGPIEEVVIKRPGRGQGAAYAFLRFQNL
DMAHRAKLAMSGRLLGRNAMKIGYGKPNPSTRLWVGGLGPNTSLAALAREFDRFGSIRTV
DYVKGDSFAYIQYESLDAAQAACTQMRGFALGDRRLRVDFATVSPDEAAAAASRYAPLQT
TPYPLPLPYELLQPEAYSRHRTALDPDLRVRDRTPPHLLYSDRERPFVEAGWVNSERRSS
GQGARSRSGDRGGGGGGGSSSKTREERRRRRSLSSDRVRSRAERSPDRQRREPPERDPST
PPSPQHNHRPSSQDKPRPPTPDPPQPRRNHHPRPPEPPAERQSPGVEKGRTLPPVWCGHL
VLKNSCFPTYLHFLEGDRDVPGALLKDRSSTSGGSLAQLKIAQRLRLDQPKLEEVTRKVR
QGTAGGYAVLLATQAPQNEGAIPGEPGLQRRLLRNLVSYLKQKQAAGVISLPVGGSNKGR
DPSGMLYAFPPCDFHQLYQQSAQRLVGKLEENMIIVLVKDSA
Download sequence
Identical sequences F7C1M9
ENSXETP00000000136 ENSXETP00000000136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]