SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000000584 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000000584
Domain Number 1 Region: 23-299
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.72e-63
Family FCH domain 0.006
Further Details:      
 
Domain Number 2 Region: 332-403
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-20
Family SH3-domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000000584   Gene: ENSXETG00000000295   Transcript: ENSXETT00000000584
Sequence length 404
Comment pep:known scaffold:JGI_4.2:GL172742.1:484052:495715:1 gene:ENSXETG00000000295 transcript:ENSXETT00000000584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVIYSEVAADENTTDSFWMPNNYGSTVKRMEDGYRLCDEIVACFQDRAKIERQYALQME
EWTRKWKPLVDSSPMYGSLLRAWQAFMSATERLSELHTQIQKTLVAEDAEKIRTWQKDTY
HRKIFGGFKESCEIENGFHKAQKPWAKKLKKVEKSKAIYHKACKKEHLVSVRENSSKINP
ELTQEKLKKLAEDHEKCTQDKEKVKQRYEKSLQELNKYNPKYMEEMETVFDQSQQQEQKK
ILFLKQVLESMHKHLDITTNESAKKVYSDLNDAIVGVNDQEDLKWWKNKHGPGMIMNWPQ
LKEWTPDTEQQIVKKKKVKETDKVKLYSVTPTESSQNKAPINVPGVRVRAVYDYSGQESD
ELSFKSGDELTKIEDEDEQGWCKGVTDKGQVGLYPANYVEVISG
Download sequence
Identical sequences Q05AR4
NP_001072681.1.99540 gi|116284134|gb|AAI24013| gi|118404502|ref|NP_001072681| ENSXETP00000000584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]