SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000000726 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000000726
Domain Number 1 Region: 971-1099
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-20
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000000726   Gene: ENSXETG00000000343   Transcript: ENSXETT00000000726
Sequence length 1116
Comment pep:known scaffold:JGI_4.2:GL173120.1:245869:268281:1 gene:ENSXETG00000000343 transcript:ENSXETT00000000726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSQDTERKLLERTRARRENLQKKMADRPTAGARPAALNKRQREPLLEANNQPPAPAEEGK
PCSKPSPSKRRCSDNDATPDSGSENKQPKSPELPRNETSTVAFHQQIKVSNQTPQVSLLS
SDKELTNSNMKAAGSVKTRMQKLADQRRYWDNNVLFVVSPSSSPPAHAPPKDIMVSPPKP
QIPTVEYDTPSVRRGRFANLAATISSWEDDLSHPCVKPNNKQEKPGTACLSKDSTTSSAS
ASINSHSVRQDTASCSQRPKDTTVNKAVCSGQLDQHTLDKSVVDSTEITEKSKSPTAITY
KPNENVLPASRTLNPQKTERPASRLYSNQPASTRNGINITPVQTQQKDKVATSGGAGIKS
FLERFGEKCQEHSPAPLNQGQRTAVLTPNTKSIQERLLKQNDISSTASLAQQQKKEREKE
LAALRGRYDRGNVWIKQQDEQRKYIHLLLLKHCQKSCLKIKHAVILFKNFLDNFHPIMAE
QVPSPQKSTTLVQSQMPSECPGLENSETLTRVKTMKMHWGPAYISPANVMWEIEMNVDGS
LEEINSSGVITNIFSDILGQHDEEEEEVAECLVEQVETATDDEEREDEEEDALNISSMSL
LAPLAETVGIESPKALLSPSNRAAAGNGESCGKRQSGKLQRKHLPRAESNDSLRSLEENQ
NLLYSIDAYRSQRFKETDRLPVKQTIVRKEDVSSRLHDKKTASPRSVNIKQRMKALNNEV
NLQQTVIHQASQALNCCIDEEHGKGSETEAEAEKLLIVATEKRAALIAELNKIKNEGPQS
QKKHVSNENAPSRGCIFVSEMFLPLKADFVCNASQRMDSANYYFFMMIRAGAENMVATPL
ASISSTMKGDALAFPTTFSLEDVSNDFEICVEVYSLVQKKEGLAPDKKKKTMKSKAITPK
RLLTSITNKSNIHTPALASPGGPNAVRTSNFVLVGSHKLTLSSIGSSKFLLDKVPFLSPL
EGHIYLKIKCQVNSSVEEKGFLTMFEDVSGFGAWHRRWCVLSGYCISYWTYPDDEKRKNP
IGRVNLANCTSRKIEPANREFCARPNTFELITVRPQREGDRETLVSQCRDTLCVTKNWLS
ADTKDERNLWMQKLNQVLVDLRMWQPDACYRPTTKP
Download sequence
Identical sequences F6VRS4
ENSXETP00000000726 ENSXETP00000000726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]