SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000002701 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000002701
Domain Number 1 Region: 4-463
Classification Level Classification E-value
Superfamily Sema domain 1.96e-167
Family Sema domain 0.0000000018
Further Details:      
 
Domain Number 2 Region: 466-515
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000314
Family Plexin repeat 0.0014
Further Details:      
 
Domain Number 3 Region: 529-616
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000178
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000002701   Gene: ENSXETG00000001251   Transcript: ENSXETT00000002701
Sequence length 804
Comment pep:known scaffold:JGI_4.2:GL172666.1:1367667:1397094:-1 gene:ENSXETG00000001251 transcript:ENSXETT00000002701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVSVVRQSWRNGVSQVMTLTLDEDRGALYVGAREVIFSLDLSNIGKELRPPIIWQAPADK
KAECAQKGKSNQTECFNYIRFLEEYNQTHLITCGTYAFQPKCAYIALSGFTLDADNLEEG
KGKVPYDPAKGYTGLILDGALYSATMNNFLGTEPVIMRIVGQHNIMKTEYLASWLNEPNF
VSSAHMPESVGSEIGDDDKIYYFFTERALEYDCSSEQVVSRVARICKGDLGGARTLQRKW
TSFLKARLLCSIPELQLNFNLLKSVFKLEAEEWRSTQFFAAFQARWGDSPVSAVCQYSIH
DIQKVFDGPYKEYREQSQKWGRYSDSVPSPRPGSCITNWHRNHGVYSSLELPDNTLNFVK
KHPLMDDTVMPSQGRPLLVRRGINFTTIAVQRTLGLDKEPYDVLFIGTDNGWVNKAVSFG
STVHIIEELQVFDKSYPVNSLAVSSRKSLLYVGSQSGLVQLPFADCSKYRSCADCILARD
PYCAWNVNISRCVRADEQHRSVLLQDIQDSDTSVCEVQNMNAAVRYFSKNITIGIGTNVV
LPCQLSSNLAEPIWTFDGQDMGSDQDDSVLFDATLQALVILGVGTHHSGSYVCFSEEQGT
RLTSENYQLTVVASPSLILESRAPLDGLGLVWMMVIALGAVCLALFLAVVYLRRKLKDEL
EKGSKSMENTLVYPIKLPSQPKTPKCLPSADSDEKLWDPSSFYYSDGSLKIVPGHALCQN
STGSSSPSGNGIPGQPLPSPPLHSPNHMLLAGVRGSSSNGYIRLTLGGGVAEEHPQLGDL
NEELRWKLKQRQALPDSNPEESSV
Download sequence
Identical sequences F6X2L9
ENSXETP00000002701 ENSXETP00000002701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]