SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000002901 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000002901
Domain Number 1 Region: 333-478
Classification Level Classification E-value
Superfamily C-type lectin-like 8.07e-41
Family C-type lectin domain 0.00025
Further Details:      
 
Domain Number 2 Region: 633-767
Classification Level Classification E-value
Superfamily C-type lectin-like 6.12e-37
Family C-type lectin domain 0.0000101
Further Details:      
 
Domain Number 3 Region: 1208-1348
Classification Level Classification E-value
Superfamily C-type lectin-like 1.38e-35
Family C-type lectin domain 0.00052
Further Details:      
 
Domain Number 4 Region: 784-914
Classification Level Classification E-value
Superfamily C-type lectin-like 6.12e-35
Family C-type lectin domain 0.00038
Further Details:      
 
Domain Number 5 Region: 489-627
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-34
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 6 Region: 921-1070
Classification Level Classification E-value
Superfamily C-type lectin-like 6.58e-34
Family C-type lectin domain 0.00075
Further Details:      
 
Domain Number 7 Region: 1083-1202
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-31
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 8 Region: 208-335
Classification Level Classification E-value
Superfamily C-type lectin-like 8.77e-30
Family C-type lectin domain 0.00096
Further Details:      
 
Domain Number 9 Region: 7-138
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.23e-29
Family Cysteine rich domain 0.0000222
Further Details:      
 
Domain Number 10 Region: 138-196
Classification Level Classification E-value
Superfamily Kringle-like 9.99e-21
Family Fibronectin type II module 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000002901   Gene: ENSXETG00000001366   Transcript: ENSXETT00000002901
Sequence length 1446
Comment pep:known scaffold:JGI_4.2:GL173073.1:95779:136469:-1 gene:ENSXETG00000001366 transcript:ENSXETT00000002901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFISFSDSSIFSIYNEEHKVCLQAQISGAIVTAPCKDNNDLQKFRWISLHQLVNVGVKQC
LGATAKKDMAVVTTYSCDGTSELQKWECKNDTLFGIQGDTLHLNYGNVQHKVILYKGTGL
WSRWKVYGTTDDLCTKAYEDVYTLLGNANGQPCVFPFKFQTKWHADCTLEGRSDGRRWCS
TTSDYNKDKLYGFCPSTYFPISDTWWTTDSVTGVHYQINNQAALTWFQARKSCLQQESEL
LSITEIHEQTFLTGLSNTMTTSLWTGLNSLNFNAGWQWSGGSPFRYLNWVPGNPSSEPGI
NCVTLNTGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCY
TVKKENKIWKEALSSCRKEEGDLASFHNVEELSFISSQFEFVIEQTTKVWIGLNDQKSHM
YFEWSDGTPVSYTVWLRGEPSHRDNKQEDCVAFDPKSGHWSDDMCEMKFQYICKRKPLPF
EPGQVDIIDKGCKKGWKRHGYYCYLISDTSESFTEANQTCIGHGAYLVTVEDRFEQAYLT
SLIGLRPEKQFWTGLTDSDERGVYKWTNGERVLFTHWNSEMPGRRRGCVVMRTGNKGGLW
DVITCEEKAKFVCKQWAEGVTPPPIPTTTPEPKCPTDWKTSPEIGSCYKHFSRGEEEKRT
WFESRSFCKAIGGDLVSINSKEEETILSQLLVNYRYYNQIFWIGLQTSDPEEGFEWVDGS
ALSYENWAYGEPNNHQGIELCGELHVSYRLSWNDRHCESSADWICELKKGAPLQPEPTKS
SVPEYELTSDGWIANKDNQYFISTEIVAMDKAREFCKKNFGDLVVINDDTERKFLWRYIL
KNGKESAYFIGLTLGLDREFRWMDGSVMNYVAWASYEPNFANNDENCVVMYKNMGFWNDI
NCGYPNPYICERKNSSINATFAPTPASPQGGCPSDWITFGKRCYKIFGNGKGEATDWDSA
RTACMRFNGNLATVENELVQAFLTYNLKDLNIDVWIGMNDKNEEHRFLWTDQRGVYYTNW
AKGHPTGSRYYSADDDTDCVSIKRGSTLDAGSWFEEECSLSRGYICQTDKNPALPASPTI
APSVRFFKFGNETFKIVNSKMSWDEAWRKCKSEDSELVSITDEYTNSFLRVYTSKYREPF
WIGLNSNKTGNQYKWTDNWKLRYTKWAAEEPKKTTACVYMDIDGQWKTSSCTENYFSICK
QSDAIAPTDPPQKPGKCPPDSDDRSWIPFRGHCYLIQVSYTKXWYQASLECLRFGGSLAS
FDDSLESNFVWHQIERLEDRVKSFWIGMYQNVENKWLWLDNAPVDFVNWNIGEPSDHNDE
HCVEMYSSHGTWNNLYCSSYRGYICKIQKKDKAIALHSSIHSGETSYKIKTDAPSQGKIG
GIIIFVLLVGAGSTYAVYYVCKRQKNKPPEDNSFDNNLYFDGDRVPATHDTNILVENIEQ
NEHAIS
Download sequence
Identical sequences F6ZV66
ENSXETP00000002901 ENSXETP00000002901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]