SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000003725 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000003725
Domain Number 1 Region: 554-749
Classification Level Classification E-value
Superfamily Sec7 domain 3.01e-74
Family Sec7 domain 0.00000175
Further Details:      
 
Domain Number 2 Region: 311-488,1001-1402,1550-1657
Classification Level Classification E-value
Superfamily ARM repeat 1.02e-29
Family Plakophilin 1 helical region 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000003725   Gene: ENSXETG00000001785   Transcript: ENSXETT00000003725
Sequence length 1686
Comment pep:known scaffold:JGI_4.2:GL172684.1:2820115:2842312:1 gene:ENSXETG00000001785 transcript:ENSXETT00000003725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLIAYGHITGNAPDKGAPGKRLIDRIVDTICSCFQGPQTDEGVQLQIIKALLTIVTCPFV
EIHEGTILHTVRTCYNIYLASKNLVNQTTAKATLTQMLNVIFIRMENQALQEQQEYVIQH
QKIHSPVPYRAMGSPNLKHKNNNHLLNELPVPGNDNSTNPEQGMEAAEGNEHTEGADSCN
VTTDVESVSEISANEETPADIIEDTTDSVCKEQEEREAVDEAATSEAESGDLPPTLNLPE
SIQTNGISDDGQSISSTDNLESDSLHGQNSGAKFSHILQKDAFLVFRSLCKLSMKPLGEG
PPDPKSHELRSKIISLQLLLSVLQNAGPVFRTHEMFINAIKQYLCVALSKNGVSSVPDVF
ELSLAIFLALLSHFKMHLKMQVEVFFKEIFLNILETSSSSFEHKWMVIQTLTRICADAQC
VVDIYVNYDCDLNAANIFERLVNDLSKIAQGRSGHELGMTPTQELCLRKKGLECLVSILK
CMVEWSKDLYVNPNFQSNLGQEKNSDPESCENKTPETTGRRYSVSSKDSTVSSGIGSTST
QTSIPDDPEQFEVIKQQKEIIEHGIELFNKKPKRGMQYLQEQGMLGTMPQDIAQFLHQED
RLDFTQIGEFLGENNRFNREVMYAYVDQLDFCDKDFVSALRMFLEGFRLPGEAQKIDRLM
EKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNKMTKEQYIKMNRGIND
SKDLPEEYLSSIYDEIEGKKIAMKETKEHTIATKSTKPSVASEKQRRLLYNMEMEQMAKT
AKALMEAVSHAKAQFTSATHLDHVRPMFKLVWTPLLAAFSIGLQDCDDSEVANLCLEGIR
CAVRISCIFNMQLERDAYVQALARFSLLTASSSITEMKQKNIDTIKTLITVAHTDGNYLA
SSWHEILKCISQLELAQLIGTGVKTRYISGTGREREGSIKSYTSGGEEFMSLGNLVGVGV
DKKQMTSFQESVGETSSQSVVVAVDRIFTGSTRLDGYAIVDFVRCLCAVSMDELASVHHP
RMFSLQKIVEISYYNMNRIRLQWSRIWQVIGDHFNKVGCNPNEDVAIFAVDSLRQLSMKF
LEKDELANFRFQKDFLRPFEHIMKKNRSPTIRDMVIRCITQMVNSQAGNIRSGWKNVFAV
FYQAASDHNGNIVELSFHTVGHTVTNVFQQHFPSAIDSFQDAIKCLSEFACNAAFPDTSM
EAIRLIRYCAKYVSEKPQALREYTSDDMNVAPGDRVWVRGWFPILFELSCIINRCKLDVR
TRGLTVMFEIMKSYGHTFENHWWHDLFRIVFRIFDNMKLPEQQSEKSEWMTTTCNHALYA
ICDVFTQFYEALNSVLLSDILSQLHWCVKQDNEQLARSGTNCLENLVILNGEKFSPEVWD
KTCNCMLDIFKSTIPTLLSNWRPKPPPSVVAPPPGLKFFEKKGGPLGQVKVANPVLRFWY
DKGLADQKLFAGLLIKCVVQLELIQTIDNIVFYPATSKKEDAEHLAAAQRDTLDIHIDSE
DQGMYKYMCTQHLFKLLDCLQESHSFAKAFNSNNEQRTALWRAGFKGKSKPNLLKQETSS
LACCLRILFRMYTDEKRRDSWGDIESRLLNVCSEALAYFITVNSESHREAWTNLLLLLLT
KTLKVSDEKFKAHASRYYPHLCEIMQFDLIPELRSVLRXFFLRIGVVFSICKPEEQAQFA
GEHHSA
Download sequence
Identical sequences F6WPV7
ENSXETP00000003725 ENSXETP00000003725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]