SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000004697 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000004697
Domain Number 1 Region: 19-200
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.08e-74
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000749
Further Details:      
 
Domain Number 2 Region: 195-319
Classification Level Classification E-value
Superfamily E set domains 9.33e-46
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000004697   Gene: ENSXETG00000002209   Transcript: ENSXETT00000004697
Sequence length 567
Comment pep:known scaffold:JGI_4.2:GL173131.1:229664:269293:1 gene:ENSXETG00000002209 transcript:ENSXETT00000004697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAQHSQHGRLHTTFGLNEPYIEIFEQPRQRGMRYRYKCEGRCAGSILGETSTENNRTYP
SIKIMNYTGKGILRITLVTKNEPYKPHPHDLVGKDCRDGYYELEFGSDRTVLCFQNLGIQ
CVRRKEVREAIHTRIMRKMNPFGVREDQLLTIEDYDLNVVRLCFQVFLPDEHGSYTRALP
PVVSNPIYDNRAPNTAELRICRVNKNCGSVNGGDEIFLLCDKVQKDDIEVRFFTDNWEAK
GTFGQADVHRQVAIVFKTPPFHRSITDAVTVKMQLRRPSDQEVSEPMDFRYLPDPEDPHG
NKFKKQKTSEVMQKFKFEMQDRRDLNPPTFGVNPIKREHFTNSSGCGQRFLPMLPTKPAC
ATYNNTTSPQSRVPKFNSNIQPSLSQLPVLNSAMQDNMHSTSTMNIMETLRTAPSQPNTH
KLPYTEPTHPRPEVATSNTTSMFRPFFNYNVPSCPSVPCEIDLYKAPSNHMDISDIGQLT
SAVNAPSISSLCNGVQPINIYSTQFSYHHAMSESRLPDTSGAPPHSTSMGHEIFSDIVQS
DDNYISVESELDSILQNFGSSSEMLHD
Download sequence
Identical sequences A4IIW1
NP_001096177.1.99540 ENSXETP00000004697 ENSXETP00000004697 gi|134026232|gb|AAI36177| gi|156717270|ref|NP_001096177|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]