SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000004730 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000004730
Domain Number 1 Region: 224-295
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.84e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 284-353
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 3 Region: 344-414
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 4 Region: 404-463
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000135
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 5 Region: 121-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000458
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 6 Region: 171-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000251
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 70-111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000218
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000004730
Domain Number - Region: 38-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0104
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 471-543
Classification Level Classification E-value
Superfamily Fibronectin type III 0.056
Family Fibronectin type III 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000004730   Gene: ENSXETG00000002215   Transcript: ENSXETT00000004730
Sequence length 899
Comment pep:known scaffold:JGI_4.2:GL172865.1:954319:1000685:-1 gene:ENSXETG00000002215 transcript:ENSXETT00000004730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEGIVLLLVLPLCLALALPCHAQLQDDASGQDVCKKCHTNATCLERNKKYSCICNYGL
IGNGRTHCLDKDECQIGSYKICGNHTACHNTHGSFFCVCLDGYRPSNNHKHFIPNDGTFC
TDIDECESADICGYKGKCKNIPGSYECYCMDGYQLKNGTEPFQANSDNGCVDVDECEAED
ICGHNAKCRNVPGNHECYCMEGYRLNNGTEPFQAHSRMNLCSVIDCGQPPALLHSQMNLE
GNTTFGSQVTYRCDAGFTATAGRAMSICTSNGTWEGASLVCTVIDCGFPPVVPNALINSS
DNTTFGSNVTYTCMKGYVASSGYGFARCAQNGKWEAATLSCQVVDCGQPPSIQHTSSKFA
RNTTLGNTIAYECMSGYVKQSGNGIAVCNEDGEWDGADLICKEINCGLPPPVPNTQVILS
GTTNLGSEVEYKCVHGYYNPGNRSVSRCTLNEKWEEVNVTCKVIGILIGNVTVFNETCLR
WRKSSEIIDWEILYKFSILGKGWHQIHYVHEKDFKLLTNNSFQCLDLLPGNNYLVIMRAV
FPEMQEISINITLETAMIKRFGDITLFNTTCLQWTKSSGKNEELEEYTVLIKGQVWKPPK
ISLNIMFNFSTSSRNPVLCLMLPPEEEYIVNVTESSTGLSSSIPFRTLGHDSEDVSGTAP
LGETCLQWNRSIEENGVQEIYRIHVQEAQGQPKPNPQLLLFNISTDQGTSQVCFKIATDQ
QQLNMTEAPSPPEANTTRELDTPLPKVQFVSKYGQLPKVSIQKTDQHAPFSSYQVFVKHS
GPLCSFTCDSLEAVPYFHNISKTRAYVTAEFSPSDIPEVLEFSLGDRQYYGEFYNAPLAQ
EKDYCIILRIISRWDRVRLCAVVPSMKCFTPSRNYMNIVLPGSVAFVWFIIFLSYSAAR
Download sequence
Identical sequences F7EPC0
8364.ENSXETP00000004730 ENSXETP00000004730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]