SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000007282 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000007282
Domain Number 1 Region: 2-187
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-28
Family YWTD domain 0.00013
Further Details:      
 
Domain Number 2 Region: 414-450
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000445
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 3 Region: 320-359
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 373-409
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 284-321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000102
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 6 Region: 243-280
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000406
Family LDL receptor-like module 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000007282
Domain Number - Region: 200-240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0402
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000007282   Gene: ENSXETG00000033412   Transcript: ENSXETT00000007282
Sequence length 450
Comment pep:novel scaffold:JGI_4.2:GL172922.1:1358696:1408612:1 gene:ENSXETG00000033412 transcript:ENSXETT00000007282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGSVEGLAYHRAWDTLYWTSSTTSSITRHTVDQSRRGAFNREAVITMSEDDHPHVLALDE
CQNLMFWTNWNEQHPSIMRSTLSGQNAQVIVSTDIVTPNGLTIDHPAEKLYYSDGSLGKI
ERCEYDGSHRHVIVRSGPGTFFSLAIHNDYIFWSDWVRRAILRSNKYTGGETKVLRSDIP
HQPMGIIAVTNDTNTCKLSPCSYMNGGCHDLCLITPDGRINCSCRGDRVLVNDNRCVSKN
SSCNMFSEFECANGECIEYHQTCDGIVHCKDRSDEKQSYCEENRSCWRGFRLCGNHRCIP
NNKVCNDEDDCGDNSDELDCKISTCASTEFRCTDGTCITKSAQCNQIIDCADASDEKNCN
NTDCTHYYKLGVKTAGFIRCNSTSLCILPEWICDGANDCGDYSDELKCPAQNKQKCEENY
FECQNGRCISNAWVCDGQRDCEDGRDELHC
Download sequence
Identical sequences F6ZYS5
ENSXETP00000007282 ENSXETP00000007282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]