SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000007285 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000007285
Domain Number 1 Region: 346-609
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-49
Family YWTD domain 0.00000166
Further Details:      
 
Domain Number 2 Region: 257-337,602-653
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000235
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 3 Region: 42-79
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000393
Family LDL receptor-like module 0.00028
Further Details:      
 
Domain Number 4 Region: 85-121
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000013
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 5 Region: 3-40
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 140-171
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000419
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 174-210
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000563
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000007285   Gene: ENSXETG00000033592   Transcript: ENSXETT00000007285
Sequence length 653
Comment pep:known_by_projection scaffold:JGI_4.2:GL172922.1:1189197:1232132:1 gene:ENSXETG00000033592 transcript:ENSXETT00000007285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQTCEPDTQFVCGNGRCISNKWHCDSDDDCGDGSDESGCSLSCTDKQFRCSSGRCIPAHW
VCDGDNDCGDFSDETHCPVSPVSGACEAKQFQCHPDGNCIPELWLCDGEKDCEDGSDERG
CNGTLRQCDAKTKFACKNTVLFLCFQGRCISNAWVCDGDIDCEDHSDEDYCEGYICGPPK
YPCANDTSICLQPEKLCNGRRDCPDGSDEGDICGNAALIEIKDKIKCIYKNCIWVHIPFN
KRKKHTNKKDEKKTPHGKHECSLNNGGCSHQCIIAPGRGIVCSCPQGMHLGTDNKTCEQV
DYCTKHTKCSQVCEQHKQVVKCSCYEGWVLNTDGETCSSVDTTFEAFIIFSIRHEIRRID
LHRRDYSLLVPGLRNTIALDFHFNQSLLYWTDVVEDKIYRGKLSETSGVSGIEVVIQHGL
ATPEGLAIDWIAGNIYWIDSNLDQIEVAKLDGKMRSTLIAGGMEHPRAIALDPRYGILFW
TDWDATFPRIESASMSGAGRKIIYKDMESGAWPNGLTVDHFERRILWTDARLHYLSIYDG
TAMKEIIRGHEYLSHPFAVSLYGSDVYWTDWRTNTLSKANKWTGHNVSVIQKTSAQPFDI
EIYHPSRQPQAPNPCASENGKGPCSHLCLINFNRTAACACPHLMKLSSDKKTC
Download sequence
Identical sequences F6ZYR6
ENSXETP00000007285 ENSXETP00000007285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]