SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000009635 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000009635
Domain Number 1 Region: 801-909
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.14e-24
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 2 Region: 7-138
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.81e-16
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 242-285
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000921
Family EGF-type module 0.018
Further Details:      
 
Domain Number 4 Region: 178-220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000102
Family EGF-type module 0.022
Further Details:      
 
Domain Number 5 Region: 683-797
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000322
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 6 Region: 137-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000142
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000009635
Domain Number - Region: 292-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000972
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000009635   Gene: ENSXETG00000004424   Transcript: ENSXETT00000009635
Sequence length 987
Comment pep:known scaffold:JGI_4.2:GL173751.1:13558:54308:-1 gene:ENSXETG00000004424 transcript:ENSXETT00000009635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPSHTGVDECAEGIDNCHADAICQDTPSSFKCICKTGFKGEGTDCEDIDECDNEFNGDCV
HECANISGNYRCTCYDGFKLAHDGHNCLDVDECSHNNGGCQHTCVNTMGSYECRCKEGFF
LSDNQHTCIHRSEEGLSCMNKDHGCAHICRESPRGGASCDCRPGFELAKNQRHCILTCNH
GNGGCQHTCNDTDSGPVCSCHPKYTMHSNGKSCIEKEEPESNSTAASDMDKRVKRRLVME
TCAVNNGGCDRTCRDTSTGVRCSCPVGFTLQFDGKTCKGMSLCTKGEDARYSKGGCDHFC
RNTVXDCSCKMGFKLLTDEKSCQALGLGSALGSGRNCLQINLNNPGSFTALDDLHEVLAL
TPCGDFSQSLLVNYNSQPAQHFLNWTSKFSATIPLYNQSLALTTDNSVLFHLEVESAPPA
FVSPKAILRCVKNGGNERCFLSCQSDVHSVPGLHDAFSLTCGSPVPLRSQNGRNNESLNA
DVATVRTSTTFKVTEGTCRNVVPEEREKRLYVSDLFAHTEKHNVLYERFCFVNITCRSRA
GAGQKGAAKETFLTAEFEAELNYKEVTDSCSFTCARRKAEKRMRKTFRTLRKAISKQQFH
ARLSGKELDVGKKSSRQSDSQEMCGTGQVRVDGKCAPPLSGQGPSVAPHSVCAPPLSGQG
PSVAPHSVCAPLFSKSGISLSLIGVCPPGEFSADGFRPCDSCPLGTYQPDGGRTSCFPCG
GNLITKHPGSTSFQECETRVQCSPGHSYNTTTHRCVRCPVGTYQPEFGQNYCVSCPGNTS
TDFDGSTNVTQCKNRQCGGELGDFTGFIESPNYPGNYPANTECTWNINPPPKRRILIVVP
EIFLPIEDDCGDYLVMRKSASSNSVTTYETCQTYERPIAFTSRSKKLWIQFRSNEGNSAK
GFQVPYVTYDEDYQELIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYTA
QESREMFPKSFIRLLRAKVSRFLRPYK
Download sequence
Identical sequences F7EEG3
ENSXETP00000009635 ENSXETP00000009635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]