SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000010450 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000010450
Domain Number 1 Region: 879-1086
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-35
Family DBL homology domain (DH-domain) 0.0029
Further Details:      
 
Domain Number 2 Region: 1241-1445
Classification Level Classification E-value
Superfamily PH domain-like 6.61e-31
Family Pleckstrin-homology domain (PH domain) 0.00026
Further Details:      
 
Domain Number 3 Region: 1073-1191
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-22
Family Pleckstrin-homology domain (PH domain) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000010450   Gene: ENSXETG00000004819   Transcript: ENSXETT00000010450
Sequence length 1447
Comment pep:known scaffold:JGI_4.2:GL172989.1:284705:401636:-1 gene:ENSXETG00000004819 transcript:ENSXETT00000010450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPTLAPKPQGLDSFSSVPLPKYSSPLISRAGLIRQTNSMSRGPKPPIAPKPVLSPSSERR
STVNANNSFNKCANGKVVCPVENISNVDQYSLECSESETPDMTFEDYSTIPDSQFTDEEN
TDIECEHSSSFDTWEAPQEEVDISDNKSCSPSGVQEEDSGNPDSVPSREVESGESTNDLG
DNEDFLPLDHNECNTDETCCEGDTNTEETREEHNESPLSADVYIVNVKSLENSIVCDNTQ
YGEAAETEQDLAAEPLDNLQLTGDIVDTGNDDGQEQDSFIHDSELSVPILPSYKDEEGEH
EADTTHEINELAINNIILDNQEENIGNISTSREQMAHEDTIDDSCLIVPYENETCEEPGA
AEGSHGCDEEPSAVSHSEATEGNLADATQCSSEDQEREVREVDLTDVLPVSEVITEHEEE
DETNPYVLEDSAQSRSRKMLSVEESAQNRKDGDTQRLHCTEESGCEGENHLLNIDRKNIV
TRTRSYSGKIPGNVPETVPEETGAEFDAQLSNTEIKAIGEKMETKPIEAGRALPRKPSRF
IPYPRSYSMEGRENTVSLYIESDMMVNFSPPYLICSSGSFSQRNHHSSSGMSTPNSVVDI
PPPFELASITKKPITKSSPSLLIENECSEKCNKKKKSSFKRFLTLKFKKKTENKVHVEVN
VSSSRSSSESSYHGPSRHMDMDRRSLGNSPQLQARSGIHFRPDSPSAMLFYKDMKRKGTS
KAFNRSVARVESFEDRSRPPFMPLPLTKPRSISFPNADTSDYENIPAMTSDYENIHIPPR
RPARAGTFTEFFEDPSRALSSANENDGYVDMSSFNTFEIKQAADQEAESAYTEPYKVCPI
LGSMEEDITSDEEPKSSEEEGNCLGFPSITHCWNGPMRALTIVESLLSSEKEYVDTLKRL
HIEFHTAVLKVLGSEEEDGEDELKLRHGLSELLNIYLIHEEILAELEQRITHWEESQKIA
DIFLSRESDFQHHTAFIVAFDKMTAALDDCTLKISHLATVVRDFERYLHRGQANVKHELL
KVVQRIFQYHMILTDYLNNLCPDWTEYEDTHAALLMVSEVADRANDSMRQGENLQKLVQI
EHSVRGQRSLLQPGREFVKEGTLMKVSGRNRHPRHLFLMNDVLLYTYPLKDGKYRLKNTL
SIPGMRVSRPIVENAQNVLKVECMERCLMLSASSCTERDEWYSCISRTVQEYYKAPTVSI
YNNLEIRERLGMGLGERPPSVAHMSHAVMCMNCGSDFTLTLRRHHCHACGKIICRSCSRN
KYPLKYLKDRPSKVCNGCFAELRKRELGVEGSLSDRSDLAAMNMNSSPPLPRSTSTLSAM
FSSIHPSYFRRHKKIPSALMEAAASGENASISGYLHRCKKGKKYWKKRWFVIKGKVLYTY
TACEDKIATESLPLLGFHIVPDNWNENPKLGTVFQLYHKKTLFYSFKAADTNSAIRWVEA
IKAASVL
Download sequence
Identical sequences F7AAU5
ENSXETP00000010450 ENSXETP00000010450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]