SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000011396 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000011396
Domain Number 1 Region: 61-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000774
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 2 Region: 31-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000629
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000011396
Domain Number - Region: 105-138
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0471
Family Mitotic arrest deficient-like 1, Mad1 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000011396   Gene: ENSXETG00000005220   Transcript: ENSXETT00000011396
Sequence length 207
Comment pep:known scaffold:JGI_4.2:GL173380.1:375339:382816:1 gene:ENSXETG00000005220 transcript:ENSXETT00000011396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKELLRVKSVCCPGWKKKEPTSEDCEEALCHKPCQNGGTCVKPNMCRCPAGWGGRYCHV
DIDECRRPSKPCPQLCINTRGSYRCECQPGFTLGEDGKSCTENKAPSQLPAQQAEDASHR
LSNEIQELRNLVETLEQRLDSTLSAVQRLFPVKLSEIHSDQVHEFWERIQSLDRMDSFSD
QLMYMEEKMGECSCRSNEIEMAVNLKR
Download sequence
Identical sequences Q0VFR0
gi|110645722|gb|AAI18736| gi|118404042|ref|NP_001072194| gi|134024304|gb|AAI36171| NP_001072194.1.99540 ENSXETP00000011396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]