SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000011725 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000011725
Domain Number 1 Region: 503-801
Classification Level Classification E-value
Superfamily L domain-like 5.44e-46
Family Ngr ectodomain-like 0.0052
Further Details:      
 
Domain Number 2 Region: 29-441
Classification Level Classification E-value
Superfamily L domain-like 5.78e-41
Family Ngr ectodomain-like 0.0032
Further Details:      
 
Domain Number 3 Region: 892-1040
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.97e-31
Family Toll/Interleukin receptor TIR domain 0.000086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000011725   Gene: ENSXETG00000027076   Transcript: ENSXETT00000011725
Sequence length 1054
Comment pep:known scaffold:JGI_4.2:GL172707.1:868268:877348:-1 gene:ENSXETG00000027076 transcript:ENSXETT00000011725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGKTFKVFYFGMRRQLLFFLISILSFSGLLATNWFPKSLPCDVEQNAKGNVIVVDCSDR
HLTSIPWGIPTNVTNLTLTINHIPRISVDSFAEFTNLVELDFRCNCVPAKVGPKDHVCTK
RLDVEDRSFASLYNLRSLYLDGNQLIEFPKGLPPNLQLLSLEINNIISISRNNLSELSNI
QMLYLGQNCYHRNPCSDSFKIEKDAFKDLKNLSILSMKSNNLSFVPGGLSDSLKELYLYN
NAIQYIEEHDLENLINLEILDLSGNCPRCYNSPFPCTPCPNNAPIQIHPKAFSSLKNLQV
LRLHSNSLRSIPEQWFKNNRNLQVLDLSENFLASEISTANFLKYIPSLKSLDLSFNFELQ
VYPSDLKLSSIFSSLASLETLRIRGYVFQNLKKNNLMPLVHLPNLTLLDLSTNFIKVADF
SLFPKFKSLQTIILSNNKISPSSEANIDSCSASQVSSGHYIGRTFQEVHYFEYDENARKC
KAKDKENFTFKLFLNESCQAYGQSLDLSQNNIFFVKATDFTNLSFLKCLNLSGNAISQTL
NGSEFRNLNRLKYLDFSNNRIDLLYSTAFQELTELEVLDISNNDHYFLAEGITHVFNFTK
NLEKLTKLMMNNNQISTSTNRHLVSQSLRILEFKGNYLNILWKDGDTRYLNFFKNLNKLY
KLDISENSLTFVPPGVFEGMPPDLLELYLARNKLKTFSWDKLHLLEKLSVLDLSNNYLTT
VPRELSNCTSSIKKLILSNNKIKKLTPFFLRGSVSLKYLDLSDNLIQNIGHSSFPEDVLD
NLTELLLQGNPFKCNCNLVWLVSWINQTKVYIPNLVTGVTCSGPGAHRGQSLVLLDLYTC
EQYHLNLILHALSASFIICLMVVSVSSHLFYWDFWFIYHLFKAKIHGYKRFPKCCYDALI
MYDTKDSAVSDWVFNDLVNILEKQGNKMLNLCLEERDFLAGQPFLDNLSESIQISRKTVF
VLTRKYVKKGHFKTAFYMAHQRLIEEKVDVIILILLEKTLQRSRYLRLRKRLCANSVLYW
PSNPNSQSYFWHCLKSAIATENQMGYDKLFKDHT
Download sequence
Identical sequences F6QHI4
ENSXETP00000011725 ENSXETP00000011725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]