SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000012464 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000012464
Domain Number 1 Region: 210-473
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.28e-58
Family Protein kinases, catalytic subunit 0.0000000222
Further Details:      
 
Domain Number 2 Region: 100-240
Classification Level Classification E-value
Superfamily SH2 domain 3.27e-38
Family SH2 domain 0.0000091
Further Details:      
 
Domain Number 3 Region: 41-124
Classification Level Classification E-value
Superfamily SH3-domain 6.28e-21
Family SH3-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000012464   Gene: ENSXETG00000005650   Transcript: ENSXETT00000012464
Sequence length 485
Comment pep:known scaffold:JGI_4.2:GL172719.1:2641378:2671639:1 gene:ENSXETG00000005650 transcript:ENSXETT00000012464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCIKSRQSTPQDDMGKNNPVSRTPSLLPGQKILQEIEEQGNIVIALYPYQGIHQDDLTF
KKGEKLKVIEEHGEWWKAKSLSSKKEGFIPSNYVARVNTLETEEWFFKDITRKDAERQLL
APGNNPGAFLIRESETSKGSYSLSIRDYDPKTGDVIKHYKIRTLDNGGYYISPRITFTSI
CDMIQHYQKQADGLCRKLDKPCYSPKPQKPWDKDAWEIPRESIKLVKKLGAGQFGEVWMG
DNTKESFICLNKKEPLNEAGQTIMDPYKTIVSCQSNLQLFSHLFYGNTVQSCAFLLTGSL
LDFLKSDEGAKVILPKLIDFSAQIAEGMAYIEKKNYIHRDLRAANVLVSESLMCKIADFG
LARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGVLLYEIITTGKIPYPGM
SNSDVMTALQRGYRMPRMENCPVELYDIMKECWKEKAEERPTFDYLQSVLDDFYTATEAQ
YQQQP
Download sequence
Identical sequences F6YTB1
8364.ENSXETP00000012464 ENSXETP00000012464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]