SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000013582 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000013582
Domain Number 1 Region: 253-527
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-78
Family Protein kinases, catalytic subunit 0.000000042
Further Details:      
 
Domain Number 2 Region: 139-290
Classification Level Classification E-value
Superfamily SH2 domain 7.67e-37
Family SH2 domain 0.0000395
Further Details:      
 
Domain Number 3 Region: 62-186
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-22
Family SH3-domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000013582   Gene: ENSXETG00000006166   Transcript: ENSXETT00000013582
Sequence length 540
Comment pep:known_by_projection scaffold:JGI_4.2:GL172994.1:817372:857937:1 gene:ENSXETG00000006166 transcript:ENSXETT00000013582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CYSCTRGIAEKLISEMGNCCRKNCSCLSCVLPCVFKEEKRSGSNSFNGIVIQNPVITTQL
DGPQVPPRFVNQGEQQRNSYVALYSYEGRTPDELSFKAGDQMLIIDTTHASWWKAKLLRT
RGKAEGYVPFNYVAPVSSIESMPWFFKDIKRSEAERLLVRPGNTTGSFLIRESESQKGEY
SLSVRESESQKVFDGIAVKHYRLRKLDDGGFYITSKSKFVSMNELVEYYGKREEGLCCKL
LKPCITTGIPLPPDLCYHTADHWEINRNSLKFLKKLGQGQFGEVWEGLWNNTIPVAIKTL
KTGTMNPQDFLREAQFMKNLRHPKLIQLQAVCTLEEPVYIITELMRHGSLLSYLQNDNGT
SIHIPNQVDMAAQVASGMAYLETQSFIHRDLAARNVLVGENGVYKVADFGLARVFKNKGE
DVYEAKNDTKLPLKWTAPEAIRYNRFTIKSDVWAFGILIFEIVTYGKMPYPGLTGRQALD
KLENGYRIPKPFNCPHDLYKIMLECWNAKPEERPTFETLQWKLEDYFETDPSSYLEANNF
Download sequence
Identical sequences F7DYP1
ENSXETP00000013582 ENSXETP00000013582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]