SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000013798 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000013798
Domain Number 1 Region: 24-297
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.36e-85
Family Eukaryotic proteases 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000013798   Gene: ENSXETG00000006294   Transcript: ENSXETT00000013798
Sequence length 334
Comment pep:known scaffold:JGI_4.2:GL173157.1:522801:536229:1 gene:ENSXETG00000006294 transcript:ENSXETT00000013798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWRSIVPVSLTAAHTVAETMEFAGIILLLLVSASPTVSQNTTASPRICGSPLVSSRIVG
GTDATNGAWPWQISLRYKGSHICGGSVISNQWIMTAAHCFEYSRTPSDYQVLLGAYQLSV
ASASELLSSVARVIVNPSFTIPGGPGDIALLKLTSPVAYTEYILPVCVPSSASGFYEGMQ
CWVTGWGNIGSAVTLPYPQTLQQVMTPLISWSTCNQMYHVQSGISSNIAIVPKDQICAGY
AAGQKDSCQGDSGGPLVCQLQGVWYQIGIVSWGDGCAQASRPGVYTLVPNFKSWLSSYNA
TTDNPDTSSYAQKSHSPAIHIHTLLIATCLLLYS
Download sequence
Identical sequences B0JYS9
NP_001016055.2.99540 ENSXETP00000013798 8364.ENSXETP00000013798 gi|166796549|gb|AAI58898| gi|167908783|ref|NP_001016055| gi|213627780|gb|AAI71053|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]