SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000013959 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000013959
Domain Number 1 Region: 59-101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000785
Family EGF-type module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000013959   Gene: ENSXETG00000006380   Transcript: ENSXETT00000013959
Sequence length 156
Comment pep:known scaffold:JGI_4.2:GL173479.1:207132:216782:-1 gene:ENSXETG00000006380 transcript:ENSXETT00000013959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MECFRNLYSLLVLVGVHLMYAVNGTTVVPLCQPSESSENCTTAMVQTTHSPKPVPMKIGK
CQMEMESFCWNGQCMYLVDLDEHYCRCEKGYTGIRCSHAELIYQPMNQEYLAITLFLSSL
LLLAVVVAAFFAYKWYKTKKAELPHNEYKEVSIQNL
Download sequence
Identical sequences Q28BU9
gi|113931422|ref|NP_001039160| gi|89272484|gb|CAJ83368| ENSXETP00000013959 NP_001039160.1.99540 ENSXETP00000013959 8364.ENSXETP00000013959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]