SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000014577 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000014577
Domain Number 1 Region: 1852-2075
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.55e-36
Family Laminin G-like module 0.0041
Further Details:      
 
Domain Number 2 Region: 477-605
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-31
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 2100-2293
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-29
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 4 Region: 1344-1477
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-29
Family Cadherin 0.00091
Further Details:      
 
Domain Number 5 Region: 803-918
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-26
Family Cadherin 0.00069
Further Details:      
 
Domain Number 6 Region: 586-710
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-24
Family Cadherin 0.0031
Further Details:      
 
Domain Number 7 Region: 268-377
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-24
Family Cadherin 0.0016
Further Details:      
 
Domain Number 8 Region: 1127-1240
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-23
Family Cadherin 0.00018
Further Details:      
 
Domain Number 9 Region: 918-1018
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-23
Family Cadherin 0.0022
Further Details:      
 
Domain Number 10 Region: 1021-1134
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-22
Family Cadherin 0.00089
Further Details:      
 
Domain Number 11 Region: 1236-1360
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-22
Family Cadherin 0.0013
Further Details:      
 
Domain Number 12 Region: 376-489
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-19
Family Cadherin 0.0021
Further Details:      
 
Domain Number 13 Region: 1455-1569
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-16
Family Cadherin 0.0026
Further Details:      
 
Domain Number 14 Region: 175-286
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-16
Family Cadherin 0.0013
Further Details:      
 
Domain Number 15 Region: 695-810
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000186
Family Cadherin 0.0041
Further Details:      
 
Domain Number 16 Region: 1565-1668
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000107
Family Cadherin 0.026
Further Details:      
 
Domain Number 17 Region: 82-172
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000186
Family Cadherin 0.011
Further Details:      
 
Domain Number 18 Region: 2340-2378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000274
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000014577
Domain Number - Region: 2296-2322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00107
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000014577   Gene: ENSXETG00000006636   Transcript: ENSXETT00000014577
Sequence length 2534
Comment pep:known scaffold:JGI_4.2:GL172639.1:433038:476066:1 gene:ENSXETG00000006636 transcript:ENSXETT00000014577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TIFIVPDRRYRGKWFEISWPPDPPVRIESGSGRVYLTHRLQGGQTEVQVKVRNLEKDSDW
YLCHITIVVPKEESLEWAMYPFPYLACVDAEAPKGTPVYQLLAHYYNDESSSSGISYYLM
EGADQRFEVDKDTGAIRTTGLPLAWNKEHALTVQATDKRGKKSPYASISILVGSRPPQFT
NMTYSLYVPESTAFGEKIAVVEAVSFQNKRISYFLLMNPSGLFAITQESGELSLTHAVDY
ESEHHLYHLLVKALEMDSGLSSVTEVMIHITDDNDCSPEFLQSIYSRDSILETIPVGTSL
LQVLAQDCDSGSNAEISYYTQSLEFSVTPQGVIHSSQLLNYERANHMYEFVVVAVDSGKP
PLTGTASVRLRMANVNDEAPVFSQTVYNTFLSEDAGADTLVATVHAKDPDGDGVTYVIVG
GNEEGNFELDNQKGILKLSKTPRPKLMKRQYLLNVSAIDDNASGGPSSLRSFTQVVVGIY
DVNDNKPVFRECAQYSEVTSVLENQPPGTFVLQVEAHDADSGLNGQVKYSLMHREGTRLA
FSIDPDTGLITTLQSFDREKQREYSISVIATDQAQEPLIGICQVTIHIADINDNDPKFEN
SRYQYFLREDTPVGTSFLRTTALDDDQGVNAAINYSIAQQQPEYFRINPSTGWVYVNQPI
SQTSLITRHIVATDGGNRSSNVELTVTVTNVLNQLPQWEQSKYWVSVPEDVARDTKIVTV
KAVSPRGDPRVTYNMEDGLVSETNNPIRFYLKPNRSGGSASVLVSEPLDYEATQFFTLKI
RAQNVAAVPLASFAIVYVNVTDVNDNVPFFTSSAYEVTVPEGAEIGTSVAQVLATDLDSG
LHGKVTYVILRDGSEDHKFFSIDSESGVIYTRSTFDREKQSSYLIEVQSQDSSESARPEM
QGQPNSDTAYVRIFVSDVNDNAPRFPMQRYETSVEEDKDVGYVVITVNASDEDEGANAKL
RYQITNGNSKGIFDVDQEIGAIFITQALNYEQDTQFELRLVASDGKWENHTLVLINVINL
NDEVPIFSQTEFHGSILEAITDLPVYVLQVSATDPDQEADQSALQYSLHGQGANSEFIID
QFNGKIYIQKELDREQRATWRFLVLATDENGEGLTGFADVIIDVKDVNDNEPTFLCTTDG
CFMGYIPENSPADTTVMEMTAFDLDDPKSGRNALLTYRIVQNVQNEINLNLFAIHPSTGS
IYTVLGSLDREKNDKYLIVVEAKDGGGLSGTGTATILISDINDHAPVFTQNVYTAMVPEN
FTINSEVAVLYAWDLDEGENAMMTFSIIGGDDDRKFFIETDKIHKRGIIRLRKKMDYERI
HERSFNLTVKVEDMDFYSIAYCVIQVEDSNDHAPVFYPAVLEAISLPEDVSIGTTVVHLS
AIDLDSGQNGKFSYHILNSSDVGGLFSVATDGWVVVAGHLDRETLAEHNLVILATDLGEP
ALTGSTSVLIIIGDVNDNAPEFEAQYSPMIWENTESPHILQVNKTSTLLHVRDNDTEVNG
APFAFSLVHDPFNVHDFSLQDLHNGSAIITVLRSFDREVHQVFYLPILITDSGNPPLSST
NTLTILIGDINDHPHSSGHLDCTVYSYKGILPTVTLGKVPAPDLDEWEHKMYYLEGKSSC
PRVFSLNEATGLLTMKEGAIPGVYKLRVKVSDGTWPDVISTVRIVVHDITEEAALNAISV
RISGFTAEDFVLRPPDKISKYELMKYLLLEILQAELDNIHIFSVLNTPGLSGCMDIWFAV
SGDTRHQAEKLNGIVASSREKIESTLGVQVTQIGEYECENVKCSHQTGCLVRSSYKQTPT
MITAGSVSFGSVTILTKALCSCPSREHQHLSCSSYERNPCLNGGICVDGNMGYRCECPLS
FHGPECQQTKHTFIGQGYAWFPPMALCYESQISLDFITEKGNGLLLFNGPMSPSKYRQTE
DFIALELQNGFPLLAINHGSGTLLLQFSTKQNLADRRWHNIRIESNGKKVKMILDHCSDA
LANEADGIRQPLHDRSSCEVSTGTPGNKRSCLRFLDVYQPLQLGGVKHVLPFLHPALQFS
GFIGCLRNLKVDSKVYDLEQPLESLNSIPGCTMTDGLCAVTGSPPCGGHGFCISDLSSIR
CHCHPGYHGDNCETVLQEWNFEKDSWIHYQLHILPSLHSLSVQLMVRTRMASCTILSFVS
TNKSSFLRLEVVEGNFAVRFNFGEREHLITLPALRIDHGQWTSLSFERYDNSFTLMINKG
GGDHELTSVMGTSRLFDVDSSSILLGTSLLQGGRNDFQGCLRDIRLNGRHLPLDGLENGY
SSTVSVQGVSRGCHSDACRSQPCQSPLNCIDLWRKYECRCPADEVEVINNMTGQKHCYPS
PCMRWSCRNGGTCVAQSHQKYVCQCRDGYKGRICESIQINTAKMIGLSSGSILAISMCLL
IFIALLVSYTVWSQWGSSKFHKGGVYHIPPEHESWEDIRESVINFSEESGIEHNQNGYDK
HKLKRPLRENVQQLCSSENDLVLPRPHQPAEESHMGKSTNATFHKLQISTENRHPSFQFY
VPQMLWAADNDMKS
Download sequence
Identical sequences F6U0Q2
ENSXETP00000014577 ENSXETP00000014577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]